CAZyme Information: MGYG000001461_00112

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_00112
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682		78583.11	6.1114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 134480; End: 136528 Strand: -

Full Sequence      

MKKQVFLAAMALLVSLSGAAQNLLAKYERTLTLPLGYVCYRTAEPLKIDGKLKEASWQKA
ESTTPFVDISGKGFAKPIYNTQAKMLWDDTYLYVAATLQEPDIKARLTQRDTIIYHDNDF
EVFLDPDGDGHQYYEIETNARGVIFDLMLDRPYRSGGNFLVQWDCPGLKTAIYCDGTLNK
SKDTDRQWIVEMAIPRAALTKNFTNPLQAGNYWRVNFSRVQWLKAGGPEENWVWSPTGKV
DMHMPDRWGFVYFSNHTVGSTQEAFAYPYNMAAYQLLWAMFYTQQDQYAKEKNYLRAKEN
FFFTEADLKGLPQGAEISVEATANTYLMSITLPQEKVRYVINQEGRFSKESIPARQVKNW
LWTRINKNKSDKEYQQWFALLKECGISGVMFEGYDEKLYRLCKEAGLEAHYWKWTMNRSE
LLKVHPDWFAVNRNGESSFDKPAYVDYYRFLCPNHEGVAQYLAEDYVKEANKPYVDGVHL
DYVRFPDVVLPVSLWKNYGIEQTSELPQYDYCYCEVCRAKFKKITGQDPLDLKYPMESQS
WINFRLDAITGVVDQITKAVKGDGKNISAAVFPGPSMARKMVRQDWGNWSLDAYFPMIYN
GFYNEGPAWIGRSVKESVEAVNGRAKVYAGLFFPDIKGDFEEALDEAFDNGASGVSFFDG
PDEAYLHRLKSYLDKRGFEVKK

Enzyme Prediction     

No EC number prediction in MGYG000001461_00112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	48	249	2.3e-43	0.9725274725274725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	2.81e-75	48	250	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	4.40e-28	37	220	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
COG1649	YddW	2.42e-14	393	631	113	339	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
pfam06452	CBM9_1	1.12e-12	48	249	1	177	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
pfam02638	GHL10	2.73e-07	393	636	68	299	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ37007.1	0.0	13	680	19	686
QTO24490.1	0.0	13	680	19	686
AUI46257.1	0.0	13	680	19	686
QCQ32632.1	0.0	13	680	19	686
CUA18365.1	0.0	15	680	22	687

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.057934	0.925357	0.015567	0.000418	0.000342	0.000356

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_00112.