CAZyme Information: MGYG000001461_00270

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_00270
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	MGYG000001461_1|CGC7	105529.41	5.6895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 346466; End: 349285 Strand: +

Full Sequence      

MKKYLLLILITLLPMYLLVACSEDEKLLVSNLTVSKEVVDFNNTAGEQEIAVTTNADDWV
FKSDKAWCRPFANGQTLKISVDESDERLVREATITITAANQTKAVKVRQLGYEPAILVDK
QLFSAEAIGGDIQLSITTNVKVDVKLPEWITTAPATRAPEMITTAHTYSVKPTTLDNQRQ
EYIKITEVLPELPGSSSNKPLEVLVPVTQKGLNQYEGGTGEDIKGDNKIKVISGAASSFQ
AGSDIDKSFDGDYTTIYHSNWNNSGTNYFPIQLTYNFEVSTDVDYLIYYPRSSGNNGLFK
EVEIQSSIDGVTFTKVMDKDLQGASVASRVMFDQTIHAKSFRFIVKSGAGDGQGFASCAE
MEFYAKNPDSFDYKTLFTDATCSELKQGVTEENINECQYPFFKNIAYYMLKGKYAREFRI
DQFRAYPHPDIQSKTHKTNAYSLLDNPTGISVKANEALVVLVGDTHGKNIALKVQNLDVP
GGDGFGGITYPLNQGVNKLIMREKGLVYVMYHTSTLDDVSAAPIKIHFASGTVSGYFDSE
KHQGRWVELINKATDRYFDVLGKYAHLTFETTDLKSYAGSNGDKLIATYDKIAYSQQQLL
GLEKYDKMFKNRMYLNVMYHSYMYATSYHTAYHKSTMNAIADVGNLQTNACWGPAHEIGH
CNQTRPGLKWLGTTEVTNNIMSEYIQTTILKQDSRIQVEDMGVNYRNRYSKAWSSIIADK
RAHSLSDDVFCKLVPFWQLELYLGKVLGRTPLVQADKGGFYPDVYEYIRIHDDLKTPAAQ
QTEFVYICSKLSGYNLLDFFEKWGFLTPVDIEIDDYGIGRMTVTQARIDEMKQRVNALGL
PKPDVALEYISDNTWELYKQKPAIARGTASRSGDKLMINGWKNVVVYEVVDTETRQLKFA
SSGETTPSDNDFFTLPFTWKETYKVYAVAVDGTRVEVVL

Enzyme Prediction     

No EC number prediction in MGYG000001461_00270.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	1.04e-55	531	804	1	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
cd14948	BACON	6.52e-16	32	109	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam00754	F5_F8_type_C	1.32e-15	235	361	4	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam19190	BACON_2	6.50e-06	32	112	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam17291	M60-like_N	1.15e-04	447	527	22	107	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73117.1	0.0	1	937	1	965
QUT40967.1	0.0	1	937	1	965
QQA08808.1	0.0	1	937	1	965
QMW85440.1	0.0	1	937	1	965
QQT79916.1	0.0	1	937	1	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	8.46e-70	376	852	14	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
7BLG_A	2.97e-68	224	366	20	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD2_A	2.03e-65	375	935	33	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	2.19e-60	408	935	20	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
5EV7_A	6.88e-27	447	934	45	485	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000016	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_00270.