CAZyme Information: MGYG000001461_00607

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_00607
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000001461_1|CGC12	46167.79	9.2842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 720852; End: 722054 Strand: +

Full Sequence      

MKNGKLGLFMVLFVLLSAFSSGEKQEPMQSVVNRGLNRSTEQALLMAKELKNREGRFPKT
INKKGELATSDYAWWCSGFFPGELWYLYENHPDKELRAYAEMYTNRLENAKKITYSHDVG
FMLNCSFGNGYRLTKNPHYKDVMTTGANSLATRFKEEVGLIRSWDFNKKKWQFPVIIDNM
MNLEFFTVVSRLTGNDRFRDMAISHADKTMEHHFRPDYSCYHVVSYDTITGKPHIKQTHQ
GYADESAWARGQAWALYGFTMMYKETGKKEYLKQANHIARFIMNHPRMPEDKVPYWDFDA
PDIPNAPRDASAAAIMASALLDLSQMNPNKFGKSCRMLAEQQLRSLTSPEYLAKKGGNCN
FVLLHSTGHFPNNSEVDVPLSYADYYYVEALIRMKKLLNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	69	394	6.5e-130	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.26e-14	55	307	7	252	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50637.1	4.25e-203	14	398	14	398
QJR58403.1	1.90e-182	1	400	1	395
QJR71294.1	1.90e-182	1	400	1	395
AII67843.1	1.90e-182	1	400	1	395
QJR66954.1	1.90e-182	1	400	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.94e-116	55	397	53	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.26e-46	58	396	53	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.29e-46	58	396	54	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.80e-46	58	396	54	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	6.84e-46	58	396	54	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.30e-104	75	400	77	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	5.77e-51	57	396	52	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	7.06e-46	58	396	54	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.45e-44	45	396	12	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	2.91e-39	57	396	49	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001122	0.609731	0.388007	0.000338	0.000431	0.000341

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_00607.