CAZyme Information: MGYG000001461_01076

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_01076
• CAZy Family: GH16
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	MGYG000001461_2|CGC5	55958.59	7.1181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 497748; End: 499250 Strand: -

Full Sequence      

MIVLGVQVAEAQEKPNIILFLVDDMGWQDTSVPFWTERTVLNDTYRTPHMERLAAKGVKF
TQAYACPVSSPSRVSLMTGANVAQHQVSNWTLYKDKGTDKPHKLLTFGEWNYNGLSPVQD
YPHAFYAKCLPLLLKENGYRSCIIGKAHLGAIDTPAADPLTIGFDYNIGGHAAGAMGSYL
GENNYGNKEAGTWTKPWGVPSLEAYHGSDIFLTEVLTREGCKFMEKSVADKQPFFLYMSH
YAVHAPFVADKRFYQYYIDKGLSEKEAQYASLVEGMDHSLGALMDCLERAGVAENTIILF
MSDNGGYSVGRGGEAAQRNYPLRGGKGACFEGGIREPMIAYWPGITRPGTENATPVIIED
FFPTILEMGEVKEHQTPQRIDGVSFVKALKKGKTLTKERPLYFHYPNNWGEQREDVGLPQ
SAIRKGDWKLIHYYETGINELYNLKEDISEKNNLIKDKRYAKKGASLAKELSNYLKKNKA
NLPYFKETGLSVPYPDGTIN

Enzyme Prediction     

No EC number prediction in MGYG000001461_01076.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	8.42e-176	15	474	1	421	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	4.84e-96	15	477	1	407	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	2.51e-94	14	455	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16145	ARS_like	1.37e-93	15	458	1	414	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16143	ARS_like	1.60e-83	15	455	1	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	4.51e-225	9	497	18	499
ALJ59588.1	1.04e-223	9	497	18	499
EAR02039.1	2.45e-177	12	499	26	512
AKJ65363.1	1.17e-63	9	493	21	467
QNN23223.1	2.19e-43	5	454	23	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	1.21e-181	14	496	33	515	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	1.43e-61	14	454	4	434	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	1.68e-59	10	484	2	442	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6B0K_A	2.43e-50	13	456	1	402	Crystalstructure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_B Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_C Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas]
6B0J_A	2.49e-50	13	456	1	402	Crystalstructure of Ps i-CgsB in complex with k-i-k-neocarrahexaose [Pseudoalteromonas],6B0J_B Crystal structure of Ps i-CgsB in complex with k-i-k-neocarrahexaose [Pseudoalteromonas],6B0J_C Crystal structure of Ps i-CgsB in complex with k-i-k-neocarrahexaose [Pseudoalteromonas],6B1V_A Crystal structure of Ps i-CgsB C78S in complex with i-neocarratetraose [Pseudoalteromonas],6B1V_B Crystal structure of Ps i-CgsB C78S in complex with i-neocarratetraose [Pseudoalteromonas],6B1V_C Crystal structure of Ps i-CgsB C78S in complex with i-neocarratetraose [Pseudoalteromonas]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	1.11e-45	10	495	30	543	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
Q571E4	1.04e-41	4	407	17	386	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
Q32KJ6	1.32e-39	4	407	21	390	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
Q32KH5	6.29e-39	5	404	20	385	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
Q8WNQ7	4.21e-38	5	407	20	388	N-acetylgalactosamine-6-sulfatase OS=Sus scrofa OX=9823 GN=GALNS PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.844987	0.154435	0.000161	0.000200	0.000106	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_01076.