CAZyme Information: MGYG000001461_01340

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_01340
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
950		105226.04	5.9721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 817817; End: 820669 Strand: +

Full Sequence      

MNKLLLTTLLLGGSTLLPMHSSLLQAQKLPATYRPAKTEMYRKGWIDFNKNGIKDIYEDP
TATVDARIEDLLGQMNMNEKTCQMVTLYGYKRVLKDALPTPEWKQQLWKDGMGAIDEHLN
GFQQWGLPPSDNENVWPASRHAWALNEVQRFFVEETRLGIPTDFTNEGIRGVESFRATNF
PTQLGLGHTWNRSLIRQVGRITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYL
VAELGIEMVRGLQHNHQVAATGKHFIAYSNNKGAREGMARVDPQMSPREVEMIHVYPFKR
VIREAGMLGVMSSYNDYDGFPIQSSYYWLTTRLRGEMGFRGYVVSDSDAVEYLYTKHGTA
KDMKEAVRQSVEAGLNVRCTFRSPDSYVLPLRELINEGGLSEAVINDRVRDILRVKFLVG
LFDAPYQTDLKGADSEVESLANQAVARQASLESIVLLKNDNNTLPLDASTIRKIAVCGPN
ADETSYALTHYGPLAVEVISVLDGIREKLNNKAEVLYTKGCELVDANWPESELIDFPLTP
AEQEEIDKAVQQAQQADVAVVVLGGGQRTCGENKSRSSLDLPGRQLNLLKAVRATGKPVV
LVLINGRPQSINWADRFVPAIVEAWYPGSKGGEAVADVLFGDYNPGGKLTVTFPKTVGQI
PFNFPHKPSSQVDGGKTPGGEGNMSRANGALYPFGYGLSYTTFAYSDLQLSSSTITPQQQ
AQVRCRITNTGHRAGDEVVQLYLRDVLSSVTTYEKNLAGFERVHLQPGESKEVCFTIDRK
HLELLNLNNEWVVEPGAFKVMVGASSEDIRLNGTLTVADYGTTAPNSPTKANPVSASTNE
EAVKQVFDTNLSTVWQGNKGDYITFALQSGATVADVSIAFGRENALPAEFEIQLSSGGGQ
FLTVYSGRVTEYNKLLTYRFKETAASDLRIVLGADRVGIAEVKIKQLKQE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	154	379	4.1e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	153	810	97	758	beta-glucosidase BglX.
PLN03080	PLN03080	4.66e-91	157	803	78	769	Probable beta-xylosidase; Provisional
COG1472	BglX	1.70e-77	141	523	41	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.14e-71	454	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.93e-60	145	415	51	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77582.1	0.0	1	950	1	946
QIU94792.1	0.0	1	949	1	946
QQT77476.1	0.0	1	949	1	946
QRP57280.1	0.0	1	949	1	946
ASM65968.1	0.0	1	949	1	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	5.70e-133	145	810	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.09e-132	145	810	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	4.37e-122	54	817	4	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.28e-121	54	817	4	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5TF0_A	6.51e-120	145	810	68	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.44e-138	157	807	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	5.81e-135	145	810	89	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.71e-133	65	810	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	4.06e-119	57	810	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.30e-91	142	809	108	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000463	0.998749	0.000257	0.000209	0.000163	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_01340.