CAZyme Information: MGYG000001461_03323

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_03323
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000001461_6|CGC2	53084.95	8.0987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 191512; End: 192927 Strand: +

Full Sequence      

MRKLLSTLLIGLTLLTYQTGYAQNKGKATIKKVAPITVKTPARPVGQKDVINLVTPKLET
VRVGFIGLGMRGPGAVARFTKIPGTQVVALCDIRPESVEKTQQILKKAGLPEAASYSGTE
DAWKQLCDRDDIDLVYIATDWKHHADMGVYAMEKGKHVAIEVPAAMTLDEIWKLINTSER
TRKHCMQLENCVYDFFELTSLNMAQQGIFGEVLHVEGAYIHNLEEFWPSYWNNWRMDYNR
KYRGDVYATHGIGPACQLLDIHRGDRLKTLVAMDTKAVNGPAYIKSKTGEEVKDFQNGDQ
TSTLIRTENGKTMLIQHNVMTPRPYSRMYQVTGTDGYASKYPIEEYCLRPSKVSSEVAPD
HEKLNAHGSVPQEVKKALMEKYKHPIHVELEETAKKVGGHGGMDYIMDYRLVYCLRNGLP
LDMDVYDLAEWCSMAELTRISIENNSNAVAIPDFTRGGWNKVKGYKHAFAQ

Enzyme Prediction     

No EC number prediction in MGYG000001461_03323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	57	461	9.5e-166	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.22e-19	60	349	3	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.04e-12	61	186	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	6.27e-07	61	173	18	145	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	1.47e-05	59	235	3	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69942.1	5.68e-299	1	471	1	467
QMW86584.1	5.68e-299	1	471	1	467
QQA07623.1	5.68e-299	1	471	1	467
ALJ43391.1	5.68e-299	1	471	1	467
QUT42144.1	5.68e-299	1	471	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.90e-88	43	459	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.46e-71	59	463	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
4FB5_A	6.49e-07	52	250	17	213	Crystalstructure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42],4FB5_B Crystal structure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42]
4H3V_A	8.54e-07	116	170	60	114	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
3EVN_A	1.65e-06	58	218	3	154	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZX8	1.14e-299	1	471	1	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	2.99e-285	1	471	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	2.99e-285	1	471	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	3.47e-285	3	471	4	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	4.17e-266	1	471	1	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000889	0.997945	0.000297	0.000300	0.000281	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_03323.