CAZyme Information: MGYG000001461_03600

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_03600
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	MGYG000001461_7|CGC4	75795.86	6.623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 231666; End: 233696 Strand: -

Full Sequence      

MKQYFILLLIALSATMQAQDAWQINATNINPEQYYGVTVANGMLGIVSSADPLRTNNIIL
AGSYDKYGRGRVSNFLNGFNMLNTTLYIDGKSINKENISNFTQTLDMKRAMHTSRFDFAE
KASVSYSYLALRQLPYCALLVIEVTPHTDINLSAANQLETPDAFRDGQMYYNEINRRHAA
IKLLSTQAESPTGKLRICASSAFLFPEKAGNEPRVIHTTPNNNSHAMRFNRELKKGETYR
FCIVGSTLTSAHHPDPMNEAERLTVFASLEGYDRLIANHTKQWDELWQSDIQIEGDAQAQ
QDIHSMIYHLYSFVREGSALSISPMGLSGLGYNGHIFWDADTWIFPALLMLQPQLAQSLI
RYRIDRLEAARKNAFEHGFRGAMFPWESADSGFEETPVWALAGTFEHHISGCVALAAWNY
FCMTQDRTWLQQEGYPLIEATAEFWLSRIETDSIGRSHIRNVVAADEWAENVDDDAFTNG
VAKINLLAAAQAARLLNYPVDERWEKVASSLVIHQFSDGTTREHSSYNGETIKQADVNLL
AYPLGLITHPKQVAKDLAYYEVKVPEKDTPAMTQAIFSLLYARLGNADKAWHFFQDAYLP
NLNPPFRVIAETKGGTNPYFATGAGGVLQAVMMGFGGLHLTEKGVVQQQGILPPHWQSLT
LKGIGVKKQTYSVKKK

Enzyme Prediction     

No EC number prediction in MGYG000001461_03600.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	306	642	8.4e-99	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	5.71e-95	1	675	2	733	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.12e-62	307	642	4	384	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	4.91e-36	1	483	1	501	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	2.72e-05	38	241	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
COG3537	COG3537	0.002	272	391	292	409	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI82226.1	0.0	1	671	1	672
AHJ97309.1	0.0	3	673	6	678
QEM10436.1	0.0	17	674	24	681
QGW26879.1	0.0	13	674	18	678
QEC67782.1	0.0	18	674	20	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.22e-270	19	671	21	674	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	7.79e-56	39	659	27	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	3.59e-34	32	664	44	714	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	7.43e-27	80	673	78	722	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.31e-26	80	673	78	722	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	3.91e-76	233	673	213	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	9.27e-67	18	662	15	735	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
F1NZI4	6.38e-63	270	642	227	616	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q32M88	1.15e-58	263	645	215	609	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
Q8BP56	2.08e-58	204	645	163	608	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999079	0.000188	0.000164	0.000149	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_03600.