CAZyme Information: MGYG000001461_03792

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_03792
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000001461_8|CGC1	98492.92	6.6567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 159491; End: 162058 Strand: +

Full Sequence      

MVKRIIGGLLCCCSMVYGQNRSEAVTLTLNDHWLFSQAGTEKWLSAKVPGTVHQDLIHHQ
LLPDPFYGVNEEKIQWVENEDWQYKTSFTVSEELLNREGALLTFEGLDTYADVYLNGSLV
LKSDNMFVGYSVPVKSVLRKGENRLQVYFHSPVKRVMPQQASNGFNYPADNDHHKEHLSV
FTRKAPYSYGWDWGIRMVTSGIWRPVSLRFYDVATIDDYQVKQLSLTDEAAQLLHELEVK
SVSAQEEQAEVVVSYSLEGGAKTTIRQEVRLQPGMNRIRIPMELPHPVRWMPNGWGKPTL
YDFSAQLVCKDVTVAEQRHRIGLRTIRVVNEKDKAGESFYFEVNGIPMFAKGANYIPQDA
LLPNVTTERYETLFRDVREAHMNMIRVWGGGTYEDDRFYELADENGILVWQDFMFACTSY
PSDPTFLKRVEEEATYNIKRLRNHASLAMWCGNNEILEGLKYWGWEKKFTPEVYQEMFRG
YDRLFNELLPAKVSELDGDRFYKHSSPYFANWGRPDSWGVGDSHNWGVWYGKKTFESLDT
DLPRFMSEFGFQSFPEMKTIATFAAPEDYQIESKVMNGHQKSSIGNALIRTYMERDYIVP
EKFEDFVYIGLVLQGRGMRHGFEAHRRNRPYCMGTLYWQLNDSWPVVSWSSIDYYGNWKA
LHYQAKRAFAPLLINPVQQGDSLQVHLLSDELKALDALTLDMRLIDFNGKLIKKESIKSL
SLPANTSMCVYRQSLASLLTTEQRTNCFLSLTLKEKSGHKVAEEVYFFEPTKNLNLPQAS
VSYKVKQRNGSCELTLTSSQLAKDVFIQVPIQGARFSDNFFDLLPGETKKVTISSPALNK
EGKLDITIKHVRETY

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	791	7.8e-113	0.7845744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.27e-113	28	830	14	781	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	2.65e-20	681	773	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	3.43e-17	778	853	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	1.42e-16	78	455	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	6.55e-10	214	324	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAD48480.1	0.0	1	855	1	855
ANQ60193.1	0.0	1	855	1	855
BAC56899.2	0.0	1	855	1	855
QRP90544.1	0.0	1	855	1	855
QCT78327.1	0.0	1	855	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	19	855	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	18	855	2	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	19	855	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	18	855	2	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	19	855	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	1.22e-128	29	833	9	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	3.38e-127	33	834	13	827	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	2.69e-126	22	833	2	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	5.28e-126	22	833	2	828	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B8NW36	7.22e-126	29	834	9	828	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004475	0.791644	0.202573	0.000568	0.000362	0.000348

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_03792.