CAZyme Information: MGYG000001461_03944

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_03944
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		94429.46	6.8065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 49334; End: 51829 Strand: -

Full Sequence      

MIKYNGWLFFFIFIFSALNSRADEWIRINQLGYLPQSKKVAVFMSETPIDMQEFALIDVF
TGETKRTFRTLRAGGSIGKMLCTYRLNFSDFEEPGTYCIKAGNTVSPHFPINHRVYHGTA
DFLLHYMRQQRCGYNPFLKDSCHTHDGYIVYHPTKTGQHIDVRGGWHDATDYLQYTTTTA
NAIYQLLFAYQQNPEAFADAYNADGHQGANGIPDIIDEAKWGLDWLNRMNPAKGELYNQI
ADDRDHAGMRLPNKDLVDYGYGPGKGRPVYFCSGEPQVRGTYMNATTGVASTAGKFASCF
ALGAEVLKPFYPGFAQEIGAKADDAYQEGVKKPGACQTASVKSPYIYEEDNWTDDMELGA
IELYRTTKNTNYLTQAIEYGRREPVTPWMGADSARHYQWYPFMNMGHYRLAQTDNQRLSN
EFIRNMRSGIQRTYEKAVASPFLHGIPYIWCSNNLTTAMLTQCRLYRETTGDSTYEEMEA
ALRDWLFGCNPWGTSMVVELPLSGDYPIQPHSSLLNAGVGNTTGGLVDGPVYRSIFENLR
GVNMDGIPGRPGEDYKRFQPDQMVYHDAISDYSTNEPTMDGTACLTYYLSSLQKEGMKQA
NGEPDRNIYQDGGIIRTDPSKKQITLVFTAADKADGADPILRILKKHGIKGGFFFTGEFY
ERFPQVIQRLKADGHYVGGHSYGHLLYAAWENRDSLLVTREAFEKDLLKSYETMRKAGIA
YKDASVYIPPYEYYNKQIAAWARNMGVQVINFTPGTLTNADYTTPDMKNYRSNREIYNKV
MEVEAREGLNGHIMLIHFGTADSRTDKFYDKPMEKLIKTLKKKGYTFVFPF

Enzyme Prediction     

No EC number prediction in MGYG000001461_03944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	116	589	7.2e-77	0.992822966507177
CE4	618	750	1.1e-18	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	2.69e-64	124	589	7	374	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	6.02e-27	622	821	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd10950	CE4_BsYlxY_like	2.35e-24	617	828	1	182	Putative catalytic NodB homology domain of uncharacterized protein YlxY from Bacillus subtilis and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis putative polysaccharide deacetylase BsYlxY, encoded by the ylxY gene, which is a member of the carbohydrate esterase 4 (CE4) superfamily. Although its biological function still remains unknown, BsYlxY shows high sequence homology to the catalytic domain of Bacillus subtilis pdaB gene encoding a putative polysaccharide deacetylase (BsPdaB), which is essential for the maintenance of spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. However, disruption of the ylxY gene in B. subtilis did not cause any sporulation defect. Moreover, the Asp residue in the classical His-His-Asp zinc-binding motif of CE4 esterases is mutated to a Val residue in this family. Other catalytically relevant residues of CE4 esterases are also not conserved, which suggest that members of this family may be inactive.
COG0726	CDA1	8.30e-23	605	828	48	251	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10948	CE4_BsPdaA_like	1.65e-22	593	828	15	221	Catalytic NodB homology domain of Bacillus subtilis polysaccharide deacetylase PdaA, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis pdaA gene encoding polysaccharide deacetylase BsPdaA, which is a member of the carbohydrate esterase 4 (CE4) superfamily. BsPdaA deacetylates peptidoglycan N-acetylmuramic acid (MurNAc) residues to facilitate the formation of muramic delta-lactam, which is required for recognition of germination lytic enzymes. BsPdaA deficiency leads to the absence of muramic delta-lactam residues in the spore cortex. Like other CE4 esterases, BsPdaA consists of a single catalytic NodB homology domain that appears to adopt a deformed (beta/alpha)8 barrel fold with a putative substrate binding groove harboring the majority of the conserved residues. It utilizes a general acid/base catalytic mechanism involving a tetrahedral transition intermediate, where a water molecule functions as the nucleophile tightly associated to the zinc cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI47497.1	0.0	3	828	2	828
QUT66756.1	0.0	3	828	2	828
QCQ33880.1	0.0	3	828	2	828
QKH86859.1	0.0	3	828	2	828
QPH59586.1	0.0	3	828	2	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	6.03e-36	26	587	18	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	7.98e-26	34	612	2	553	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	1.71e-22	34	612	2	553	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
4CJ0_A	3.21e-20	19	618	23	572	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	3.33e-20	19	618	37	586	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S4	1.76e-19	19	618	23	572	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	1.87e-19	19	618	47	596	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
P14090	1.11e-17	26	596	341	911	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
A7LXT3	2.40e-17	23	592	29	578	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
Q05156	5.72e-17	26	596	185	746	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004010	0.994592	0.000758	0.000213	0.000197	0.000215

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_03944.