CAZyme Information: MGYG000001464_02402

Basic Information

• Species: Fusobacterium polymorphum
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium polymorphum
• CAZyme ID: MGYG000001464_02402
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		22290.67	5.0364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001464	2566364	Isolate	not provided	not provided

• Gene Location: Start: 805728; End: 806312 Strand: +

Full Sequence      

MKKRMFVFLVLLLFSTRISYSEEERSNFTNKVKEYVIENVGDFELANELYGYIKYYAKEY
GVEEELVVSVIKVESNYDVIAVSPVGAIGLMQLMPKTAEYLGVEADYISENIKGGVKYLK
ECLSKNGEDIALALAAYNAGLGAVKKYSSIPPYRETQKYIEKVLKEYNKLKKEKYVHNIV
EFKEDSKIAFEDEF

Enzyme Prediction     

No EC number prediction in MGYG000001464_02402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	64	176	6.7e-28	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.27e-45	64	168	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	3.27e-37	52	169	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.50e-34	52	164	9	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.59e-26	53	159	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.19e-23	1	178	93	291	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV71382.1	1.11e-126	1	194	1	194
ASC04268.1	1.11e-126	1	194	1	194
ALM95353.1	1.11e-126	1	194	1	194
ASG29718.1	6.43e-126	1	194	1	194
ALF24927.1	7.51e-125	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.36e-07	56	164	423	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.36e-07	56	164	427	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.36e-07	56	164	433	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.37e-07	56	164	437	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.37e-07	56	164	443	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.24e-29	41	167	56	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.14e-25	51	169	1424	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.14e-25	51	169	1424	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	2.50e-09	59	170	17	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q0A9W6	6.39e-08	57	142	300	392	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000560	0.998610	0.000285	0.000178	0.000175	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001464_02402.