CAZyme Information: MGYG000001465_01300

Basic Information

• Species: Providencia alcalifaciens_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens_A
• CAZyme ID: MGYG000001465_01300
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36023.9	6.5061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001465	4108375	Isolate	not provided	not provided

• Gene Location: Start: 218204; End: 219184 Strand: -

Full Sequence      

MSDMQLLQGAAYDVQSLTSLKGELNKSPEQGLRQVTQQLEATFVEMMLKSMRSALPQDGM
FSSDQTRMMTSMYDQQIAQDLAQKGLGFGEMMYQQLTRDQSPSSPAQGAFMPLNEQDLQS
LPPFALEQMVRRFAPAMGDALASPFKQIKSLSLNSSNFINQLIEPAKNASEKSGISHFLI
LAQAALESGWGKREILTAEGKTSHNLFGIKAGKNWQGPVTNIMTTEVINGKTIKMRDDFR
VYGSYEEAISDYISLLTENPRYKDVKHAATPEIAARRLHKAGYATDPGYSDKLITLINQI
RGSGSVANTSASRAIQAYNIDLNDIF

Enzyme Prediction     

No EC number prediction in MGYG000001465_01300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	165	300	4.2e-34	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	1.21e-147	1	322	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.39e-103	10	301	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12709	flgJ	1.05e-81	6	300	10	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12712	flgJ	1.43e-80	5	300	11	342	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	2.37e-78	8	312	13	338	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLR06189.1	2.80e-229	1	326	1	326
QLQ98742.1	4.96e-223	1	326	1	326
SQI34035.1	4.96e-223	1	326	1	326
ATG17849.1	4.96e-223	1	326	1	326
VEH54966.1	5.11e-202	1	326	1	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	2.14e-51	153	326	1	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	3.77e-51	153	305	1	154	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.07e-32	158	298	4	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.38e-32	158	298	5	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.05e-31	158	298	5	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	2.24e-89	3	326	4	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	1.51e-86	2	326	3	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	3.02e-86	2	326	3	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9I4P4	2.73e-40	9	307	16	392	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	8.63e-38	9	300	9	305	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001465_01300.