CAZyme Information: MGYG000001465_03605

Basic Information

• Species: Providencia alcalifaciens_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens_A
• CAZyme ID: MGYG000001465_03605
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		27801.12	10.13

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001465	4108375	Isolate	not provided	not provided

• Gene Location: Start: 188637; End: 189359 Strand: -

Full Sequence      

MQKFVSRLWYWLKKITLSLLALWLVSVVIFKFIPVPFSAVMVERQLSAWVNFNFSYVSHS
TWVSEKQISPYLYLAVIASEDQNFPHHWGFDLDAIERAYKHNSSNKQTVRGASTISQQTV
KNLWLWDGRSWIRKGLETAMTPVMELMWSKTRIITVYLNIAEFGEGVFGVEEAANKFFNK
PASKLSRQEAALLAAVLPNPHRFHVKNPSSYVLKRQAWILNQMSLLGDRNYLKNNDIGEE

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	56	223	2.6e-55	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	3.61e-130	1	236	1	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.37e-83	10	227	2	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.71e-69	34	223	51	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.03e-68	56	223	9	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	8.00e-33	63	227	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLR04290.1	1.45e-172	1	240	1	240
SQI40799.1	9.78e-171	1	240	1	240
ATG16180.1	9.78e-171	1	240	1	240
QLQ96939.1	9.78e-171	1	240	1	240
VEB74934.1	1.41e-154	1	240	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.35e-24	62	223	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.21e-24	62	223	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.43e-19	75	227	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	2.93e-19	60	232	57	232	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	3.88e-19	60	232	74	249	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N087	2.11e-111	8	237	8	237	Biosynthetic peptidoglycan transglycosylase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mtgA PE=3 SV=1
A1JR77	3.13e-106	5	237	8	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mtgA PE=3 SV=1
B1JL77	8.94e-106	5	237	8	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mtgA PE=3 SV=1
Q3V7N9	1.27e-105	5	237	8	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mtgA PE=3 SV=1
B2K3Y6	1.27e-105	5	237	8	240	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42