CAZyme Information: MGYG000001466_00034

Basic Information

• Species: Providencia alcalifaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens
• CAZyme ID: MGYG000001466_00034
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000001466_1|CGC1	64292.78	8.5254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001466	4044196	Isolate	not provided	not provided

• Gene Location: Start: 36512; End: 38197 Strand: +

Full Sequence      

MSMTAPSITTPKKSALMLFFLFLLIYLLPGIYGHSPWKQDENYSFGIIQTMYETGNWLVP
TNAGEPFMEKPPLYYWTATVFSHLLSGVMPLYDAARSASLFFSIINFSFFVLLARRFFKS
EHFADARIWTAFALYVCAPGVLRHTHEMFTDVSLMTGATIGLYGLLGLIQQQKITASACW
LALGTIITTLSKGVFIPGVLWISLLLAPVFITQCRIKLFWLPTLLAGVVALIAILPWPIM
LYVQHPELFVTWFWENNIGRFLGFSVEKLGAKANFTRIPSAIVFFALPAGLLATAYFLRH
PLKRLRDRNEYLLVIFPVLGVTFLQMSASGRALYLLPFIAPMAILAVHTLGWFSDKALNV
FARFSALFWSGLILFLWVCYVIVLMGHQALWLPVFGRWLPLDYHLEFSIFSLISGMFITC
FWFFRHRLISSSNTAFLAMRNWSLGMVSVWSIILTLFVGWIDYSKGYEGVFVDLRHHLEG
QFAPNDCMASQGLGESETPMLYYYTGILHQRQMHFEKPQHCRWLIVYSKEVNPAPEGMEF
FWSNHRPDEFHENLVVYRATE

Enzyme Prediction     

No EC number prediction in MGYG000001466_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	12	460	4.6e-41	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.48e-20	29	385	23	368	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.18e-08	33	454	25	422	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UAC69887.1	2.04e-103	26	560	72	624
AJP53169.1	7.75e-15	10	350	2	331
QQD26204.1	7.75e-15	10	350	2	331
AVB20309.1	1.02e-14	22	350	16	332
SOS34071.1	1.02e-14	22	350	16	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48HY9	3.29e-14	22	350	15	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1
Q4ZSZ0	2.46e-13	22	368	16	350	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q4KC80	4.30e-13	22	350	14	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q3KCB9	4.30e-13	21	350	13	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q3KCC9	7.83e-13	6	368	15	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.999104	0.000159	0.000141	0.000129	0.000126

TMHMM  Annotations     

start	end
13	35
73	92
99	118
128	145
152	169
184	206
218	240
276	298
311	328
332	354
367	389
404	426
439	461