CAZyme Information: MGYG000001466_00101

Basic Information

• Species: Providencia alcalifaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens
• CAZyme ID: MGYG000001466_00101
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000001466_1|CGC2	61934.49	9.2203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001466	4044196	Isolate	not provided	not provided

• Gene Location: Start: 118886; End: 120532 Strand: -

Full Sequence      

MMMANNKKAYLKWCLLFGFVLITYFLPLNGRMLWQPDELRYAEISRELILSSHWSVPELL
GIRYFEKPIFGYWVGSFFQMLFGENNVSVRLGVVFSTLISGLFVYLSAKMAWKNKDLAFN
AVLIYLSMFMILTIGTYNILDPIVTAFITMIIFFFQWGITTTQRAHKLYAYILIGVACGL
GVMTKGFLVLVLPVLVCSVSAIYFKKLKEICLYALVSILVAILVCLPWALTIASLEPDFW
SYFFWVEHIQRFMADNAQNKSPFWFYVPILVAAVLPWLGYLVSSIAYAIRAKGINLYFLL
WAVLPFLFFSITKGKLLTYILPCIAPIAILMASYLQQVLTQNKVATIRLNALINITLGVV
AAGAFIASPYFPKMNLYQGDESYKMWIAAGAFLFWAAMGIVSFNRKYWSWAAACTLALSL
SIGHVIPKYIESNNTPQGVLAKYQDQLQNRAVLLTNNVGLGTALAWVLKRDDITMLYQTG
ELGYGLNYPDAENRFYRLEQLPSLLASQNNRNVAVVVDASQNEVIDALPGTPIIIKEGKL
VMAFYEGQ

Enzyme Prediction     

No EC number prediction in MGYG000001466_00101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	514	8.3e-112	0.9462962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	6	546	1	551	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.63e-64	2	498	1	510	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	7.49e-15	15	243	7	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	8.79e-07	67	185	2	115	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1287	Stt3	0.003	68	371	96	374	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI31470.1	0.0	1	548	1	548
ATG15220.1	0.0	1	548	1	548
QLQ97962.1	0.0	1	548	1	548
QLR05257.1	0.0	1	548	1	548
VEH53664.1	0.0	1	548	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.67e-30	4	388	24	414	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4EUL1	3.88e-172	12	545	10	547	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	2.39e-153	3	548	1	552	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B4ETL9	3.38e-153	3	546	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A8GDR9	4.65e-151	13	548	8	554	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
C5BDQ8	1.12e-145	13	548	7	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
86	108
117	139
143	161
168	183
187	204
211	233
264	286
293	312
316	335
348	370
385	402
407	426
446	468