CAZyme Information: MGYG000001466_00120

Basic Information

• Species: Providencia alcalifaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens
• CAZyme ID: MGYG000001466_00120
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
151		17089.03	8.8564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001466	4044196	Isolate	not provided	not provided

• Gene Location: Start: 3423; End: 3878 Strand: +

Full Sequence      

MIKLIILLFLSFGVYANCWQHAASIYGIEPELLYAIAQQESGLKPYVIGKNKNGSKDLGV
MQINSSHLPRLKELGINEKQLLEEPCLSVVVGASILSDMMKVYGYSWEAVGAYNAGISEK
RKVARMNYAEKVWFHYKKIKEEKLIGKLDFE

Enzyme Prediction     

No EC number prediction in MGYG000001466_00120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	28	144	1.3e-21	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.15e-75	4	141	7	144	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	2.70e-53	26	138	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	8.16e-31	19	133	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	4.49e-24	5	145	8	151	lytic transglycosylase; Provisional
COG0741	MltE	9.56e-14	15	126	139	250	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAQ60311.1	1.00e-60	16	139	18	141
QIY81203.1	1.00e-60	16	139	18	141
ATP32947.1	2.86e-60	16	139	18	141
ATP29038.1	2.86e-60	16	139	18	141
SQH92580.1	3.13e-59	13	141	16	144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	9.08e-14	17	101	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	1.19e-57	15	141	18	144	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
P0CL15	1.69e-57	15	140	18	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
E1WAC2	1.69e-57	15	140	18	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
Q55287	3.08e-39	5	142	7	144	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	7.10e-38	16	142	18	144	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.042875	0.850918	0.105042	0.000375	0.000342	0.000425

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001466_00120.