CAZyme Information: MGYG000001466_02162

Basic Information

• Species: Providencia alcalifaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens
• CAZyme ID: MGYG000001466_02162
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001466_30|CGC2	38502.44	8.7516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001466	4044196	Isolate	not provided	not provided

• Gene Location: Start: 175487; End: 176563 Strand: -

Full Sequence      

MSQAKKLLVMAGGTGGHVFPGLAVAHYLQAQGWEIRWLGTADRMEATLVPKHGIDIEFIQ
ISGLRGKGIGALLGAPWRIYKAIRQAKSIIQRYQPDAVLGMGGYVSGPGGIAAWQCGVPV
VLHEQNGIAGLTNKWLSKIAKRVLQAFPGAFPNAPVVGNPVREDVLALPAPQERLTGRDG
AVRVLVVGGSQGARILNQVMPLVAGKVSKQLNIWHQAGKGSKESTEALYNDFLQNSGDSE
FKVTEFIDDMAQAYAWADIVVCRSGALTVSEIAAAGLPAIFVPFQHKDRQQYWNALPLEQ
AGAAKIIEQPQFTAEAVAELLNKWDRTELLSMAEKAYSCAITDATERVAAVICDVAKK

Enzyme Prediction     

No EC number prediction in MGYG000001466_02162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	184	344	2e-49	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	0.0	5	358	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.32e-150	6	351	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.83e-149	5	352	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	7.85e-148	5	358	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	2.78e-56	7	145	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLQ96452.1	6.94e-262	1	358	1	358
ATG16611.1	2.83e-261	1	358	1	358
SQI39782.1	2.83e-261	1	358	1	358
QLR03894.1	3.26e-253	1	357	1	357
VEH56165.1	8.18e-245	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	2.06e-190	3	357	5	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.42e-89	7	357	5	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.27e-88	2	352	7	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4F111	4.57e-202	1	358	1	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=murG PE=3 SV=1
Q7N147	2.56e-200	3	358	4	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=murG PE=3 SV=1
Q6D0I3	1.14e-191	3	352	4	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=murG PE=3 SV=1
B4SU50	2.00e-190	3	357	4	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Salmonella newport (strain SL254) OX=423368 GN=murG PE=3 SV=1
A7FM66	2.08e-190	3	352	4	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001466_02162.