CAZyme Information: MGYG000001468_01225

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_01225
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor RpfB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		38479.41	4.7943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 1217611; End: 1218702 Strand: -

Full Sequence      

MRRSLRLSLFAVVLLGLIGGTLAFFVAQKSVVLTVDGEAQRVGTYADTVAEVLKEEGLQP
AAHDVLLPAADQAVADGDTIVLNRARPLLLSVDGVEQEVYVTALSVDEALEQLGLRSDNL
VLSASRSERLPLDGMRLAVTTPKDVVLVSDNQERVVTTTAATGADLLAEQGIVLSATDRA
SVDLALPLVHQMRLQVFRVGISDVTVTEPIAHEVVETKNPEAFVGDKKVTTAGVDGERTV
TYRVTVTDGVETAREQLSASVTRQPVTEQVTVGSKARPANTPSADGLNWAALAKCESGGR
PNAVSGTGKYRGMYQFSQSTWNAVGGTGDPAAASADEQTYRAQLLYQRSGAGQWPHCGPR
LFG

Enzyme Prediction     

No EC number prediction in MGYG000001468_01225.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	2.01e-58	12	299	21	302	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
cd13925	RPF	3.93e-30	288	357	2	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam06737	Transglycosylas	6.90e-24	285	357	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
pfam07501	G5	1.81e-22	202	275	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	7.32e-09	31	71	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG01708.1	6.61e-189	1	363	1	363
ADB73667.1	1.47e-174	1	362	1	365
CCH86399.1	4.08e-153	1	362	1	366
QXG74965.1	2.24e-147	1	361	1	373
QNG37597.1	1.80e-121	1	361	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	4.55e-27	123	360	5	244	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
3EO5_A	6.90e-16	201	360	6	167	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
2N5Z_A	3.47e-15	288	358	8	77	Mycobacteriumtuberculosis: a dynamic view of the resuscitation promoting factor RpfC catalytic domain [Mycobacterium tuberculosis H37Rv]
4OW1_A	4.52e-15	288	358	5	74	ChainA, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_B Chain B, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_E Chain E, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_S Chain S, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_T Chain T, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_U Chain U, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_W Chain W, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_X Chain X, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis]
4CGE_A	8.78e-13	287	360	2	74	ChainA, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_B Chain B, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_C Chain C, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_D Chain D, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_E Chain E, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_F Chain F, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H8EZH5	6.77e-51	27	360	23	358	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG28	6.77e-51	27	360	23	358	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	6.77e-51	27	360	23	358	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
A0R3E0	2.28e-47	27	361	23	359	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
Q6M6N7	1.56e-39	5	361	20	371	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.876059	0.104600	0.008411	0.000940	0.000544	0.009474

TMHMM  Annotations     

start	end
5	27