CAZyme Information: MGYG000001468_01566

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_01566
• CAZy Family: GT94
• CAZyme Description: GDP-mannose:glycolipid 4-beta-D-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000001468_1|CGC10	37215.77	10.5732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 1558742; End: 1559731 Strand: -

Full Sequence      

MVLHSLREPDGTTQYVDQIIGGTPPGVRIRLFDWSTALVGRYDVLHVHWPELLIRDSRRP
WLRFVKRRLLALLLLRLRVQRIPLVWTAHNLDPHEQGTRSDRRALDRFSRRVDLVIRLNS
ASPVTIGRERVTIPHGHYREPFSRYHQPAAERGRLLHVGIIRPYKGIDTLIEAFRGVDRA
DLRLRIVGAPHPGQAELVEAAGRGDRRIESLLRKVSDRELVEEISRAQLVVLPYRGSMHN
SGALFAALSLGRPVLVPESPTNAALSDEVGPGWILEYPGELTAEVLEKAVHATLTPPEGE
PGLDDRDWARIGLLHRDAYRRALALTGRS

Enzyme Prediction     

No EC number prediction in MGYG000001468_01566.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	41	322	5.8e-100	0.9964664310954063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	1.82e-17	81	268	104	314	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd03801	GT4_PimA-like	3.00e-13	40	320	81	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.29e-11	41	289	83	339	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd01635	Glycosyltransferase_GTB-type	1.32e-08	130	275	81	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03809	GT4_MtfB-like	8.09e-08	131	233	165	276	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHF21964.1	1.07e-114	1	324	16	338
QHC74783.1	8.70e-114	1	324	16	338
QHC71471.1	1.42e-112	1	324	16	338
QHC56592.1	2.23e-111	1	324	16	338
AZZ56359.1	2.31e-111	1	324	16	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56775	7.78e-77	2	327	20	345	GDP-mannose:glycolipid 4-beta-D-mannosyltransferase OS=Xanthomonas campestris pv. campestris OX=340 GN=gumI PE=1 SV=2
Q8P804	4.39e-76	2	327	20	345	GDP-mannose:glycolipid 4-beta-D-mannosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=gumI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000018	0.000005	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_01566.