CAZyme Information: MGYG000001468_02059

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_02059
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		38422.67	7.6055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 355257; End: 356342 Strand: +

Full Sequence      

MTVEQLWQPVPGGSGTYIRELLAEYARMPDVSATGISAWHDAAAVAEAAPGVALRRLPLP
RPALYAAWERARRPRAGRSADVVHATTWAVPGSRVPLVVTVHDLAFLHDPDHFTARGVRF
FRRALEITRAEAAAVIVPSQATRADCIAAGIVEDRLHVVPHGVRPPATTPADAVTFAERH
GLRRPYVLWAGTREPRKNLPTLVSAFARVLAEGADLDLVLVGPQGWGPEQAALSGPDAER
VHLLGHLPTAELAAAYAGALAFCYPSLREGYGLPVTEAMSHGTPVVTSRGTSTEEVAGGA
AVLVDPRDDADVARGLREAIEPAANARLRQLSSARAAELDWSVTARATTTVLRRAAGVAE
R

Enzyme Prediction     

No EC number prediction in MGYG000001468_02059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	183	321	4.1e-26	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.25e-75	10	348	12	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	2.50e-45	9	353	11	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.08e-38	1	357	4	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03821	GT4_Bme6-like	3.10e-27	65	348	82	375	Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.
cd03811	GT4_GT28_WabH-like	2.58e-24	59	330	69	336	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN84791.1	5.41e-122	1	356	31	390
ADG75251.1	4.98e-119	1	320	9	337
QGQ20918.1	2.45e-113	1	353	11	369
QVI64866.1	9.56e-113	1	356	9	369
QAY64822.1	1.58e-112	1	345	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2R60_A	1.94e-06	153	321	220	423	Structureof apo Sucrose Phosphate Synthase (SPS) of Halothermothrix orenii [Halothermothrix orenii],2R66_A Complex Structure of Sucrose Phosphate Synthase (SPS)-F6P of Halothermothrix orenii [Halothermothrix orenii H 168],2R68_A Complex Structure of Sucrose Phosphate Synthase (SPS)-S6P of Halothermothrix orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8HCF8	5.65e-10	12	348	26	398	D-inositol 3-phosphate glycosyltransferase OS=Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) OX=452863 GN=mshA PE=3 SV=1
P26402	1.96e-08	99	309	109	309	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
O07147	8.89e-08	159	345	166	353	Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=pimA PE=3 SV=1
D5UJ42	1.04e-07	69	312	130	398	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
Q1ARU5	5.37e-06	150	313	190	371	Trehalose synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=treT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_02059.