CAZyme Information: MGYG000001468_02063

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_02063
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		39053.26	5.8724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 359239; End: 360273 Strand: +

Full Sequence      

MKIIIVTSMVPFVEGGAESLATWLSDALERRGHEVDLFPIPVQGQTDLLPGQMVGLRSMD
FTGMGDRLIAIRTPSYLVRHHHKILWFIHHHRPSYDLWDEYRDVPNDPDGWEFRRMMFAS
DEVALAEAKQIFTNSARVRDRLRHYNGVDAEVLYPPLPEGLDVTPGPYGDYLFSISRIQQ
HKQQLLTVEAMAHTETPVRLVLAGRGANDGYAEQIERRVRELGLTDRVTFHHERVPDEKK
WSLMSGALASVYLPREEDSYGYVGLESALARRPLVTATDSGGVLELVRDGVNGLVTAPQP
EALAQAFDRLYRDRELAARLGAGHDQRLREMNIDWDHVVERLVS

Enzyme Prediction     

No EC number prediction in MGYG000001468_02063.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	170	321	5e-21	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.51e-33	2	344	1	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	8.49e-28	1	342	1	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	4.83e-23	171	321	4	152	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	2.38e-22	2	333	1	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03805	GT4_ALG2-like	1.60e-21	128	322	155	373	alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN62866.1	9.02e-105	1	344	1	345
AND71048.1	1.62e-102	1	344	1	344
AVQ03341.1	4.75e-102	1	344	1	345
ADG11697.1	4.75e-102	1	344	1	345
AZH12208.1	9.53e-102	1	344	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XSO_A	4.71e-10	118	322	150	358	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]
6TVP_A	8.76e-09	146	344	185	394	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4JAK2	2.98e-14	146	330	163	334	Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=agl16 PE=3 SV=1
Q2JFV0	1.63e-09	147	323	218	403	D-inositol 3-phosphate glycosyltransferase OS=Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) OX=106370 GN=mshA PE=3 SV=1
Q7KWM5	1.19e-08	171	330	229	402	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
A0R2E2	4.63e-08	146	344	171	380	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1
P9WMZ0	1.96e-07	11	344	12	380	Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998823	0.001206	0.000006	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_02063.