CAZyme Information: MGYG000001468_02940

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_02940
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671		73368.57	9.8995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 65358; End: 67373 Strand: -

Full Sequence      

MDVVTAAETSGRTARPGEGTPQVPVPSTGRAPAYERRESGRLYGRTATEVTGPLQPTGDR
VRYREALTPRQRFGVLALGGTHMTAALALTVVVLLPQNLPLLGRAPLVDALAVGGVVVMV
LLQLVAAWRTWTIAYHAGRALDPIPMRPPAGLRVAVLTTIVPGKEPVELVMATLRAMRRI
RHDGVLDVWLLDEGDDPEIRRRCEELGVRHFSRKGRFEWNRPGGPYRARTKHGNHNSWRA
DHELDYDVVAQMDPDHVPFPNFLERTLGYFADPDVAFVVAPQVYGNLDESFVVRGAAELA
YLFHGVIQRGGNGHDAPLLIGTNHLYRPTAFRQIGGYQDSIIEDHLTSMALYAAANPETG
RTWKGVYTPDIVAVGEGPATYSDFFSQQKRWAYGIWQIARQHSPRVLPLLGSPQQRRSFL
ALQSHYPTTAFVWVGGVLLSVLYLVGGVTVTHLPLVQWSLLFAANMALGLAFTVGMRRFN
LVEHERRSWGLSGLALDLVTAPVYVAAAAAQLAGRPLVYVVTAKGSAATRDTWRTFRPHL
LWAGTALGAMAAGVLLDHHYPALYVWAAVTALISLAPLTHVTVIALVHALSGRSVTRAPV
VPARRIGEVLVAKGVLTREQLRHLLDLQAVREEGWLPLGELAVVEGFITPDQAGRGLLPG
PRRAQLEPQPA

Enzyme Prediction     

No EC number prediction in MGYG000001468_02940.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	249	462	4.3e-17	0.934010152284264

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.92e-70	156	399	3	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.39e-35	157	474	56	361	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	6.88e-28	164	402	8	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	2.25e-21	186	394	33	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	3.85e-19	160	344	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH86660.1	0.0	35	635	4	604
AEV84338.1	5.34e-273	54	652	1	596
ATO82730.1	5.34e-273	54	652	1	596
SLM00137.1	5.34e-273	54	652	1	596
QLQ36300.1	1.97e-176	5	577	7	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.26e-18	143	415	119	395	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.38e-18	143	415	131	407	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.38e-18	143	415	132	408	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	5.95e-15	186	404	306	510	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58932	2.10e-17	143	426	142	411	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
Q67VS7	8.56e-15	188	401	126	334	Probable glucomannan 4-beta-mannosyltransferase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA9 PE=2 SV=1
P37653	3.23e-14	186	404	306	510	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	4.25e-14	186	404	306	510	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P58931	8.73e-14	186	554	192	540	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996980	0.003031	0.000012	0.000006	0.000003	0.000006

TMHMM  Annotations     

start	end
73	95
105	127
429	451
456	475
488	510
539	556
563	585