CAZyme Information: MGYG000001468_03210

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_03210
• CAZy Family: CE14
• CAZyme Description: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		26839.41	6.0795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 351779; End: 352534 Strand: -

Full Sequence      

MLAVFAHPDDESLSAGGLLARQAAAGARTAVVTSTWAEDSVRARELAEALRNLGVGEPPR
MLGYADQKVPESAPGSPRFCDAPLDEAVRRLVTHIRDFRPDVVVTHDAYGGVTGHADHVH
TYRVTMLAAQAAGLEQLYPEAGAPWQPRALYLATHPRSVAARLTGLIGAQRAVYSVPDEQ
VTDRLDVSPWVEQKIAAVLAHRSEVERGAVPGLVASLPQDARVAMLSTEWFIRCAPWVSA
AGGMSTDVPAL

Enzyme Prediction     

No EC number prediction in MGYG000001468_03210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	2	117	8.8e-28	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	3.24e-30	2	208	14	198	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	1.71e-24	3	126	1	125	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
cd03278	ABC_SMC_barmotin	0.009	76	126	136	190	ATP-binding cassette domain of barmotin, a member of the SMC protein family. Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT97562.1	5.86e-118	1	233	6	237
QWA23044.1	1.54e-106	1	233	6	237
QOV37374.1	2.19e-106	1	233	6	237
QTI50266.1	2.58e-84	1	236	9	245
QNF59455.1	6.28e-73	1	232	4	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EWL_A	1.03e-13	1	232	7	274	ChainA, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase [Mycobacterium tuberculosis],4EWL_B Chain B, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase [Mycobacterium tuberculosis]
1Q74_A	1.06e-13	1	232	7	274	ChainA, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) [Mycobacterium tuberculosis],1Q74_B Chain B, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) [Mycobacterium tuberculosis],1Q74_C Chain C, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) [Mycobacterium tuberculosis],1Q74_D Chain D, 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) [Mycobacterium tuberculosis]
1Q7T_A	1.27e-13	1	232	32	299	ChainA, Rv1170 (MshB) from Mycobacterium tuberculosis [Mycobacterium tuberculosis],1Q7T_B Chain B, Rv1170 (MshB) from Mycobacterium tuberculosis [Mycobacterium tuberculosis]
1UAN_A	6.02e-08	1	225	4	197	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82IJ5	1.11e-27	1	231	9	273	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=mshB PE=3 SV=1
C1AZH2	2.92e-27	1	232	6	268	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Rhodococcus opacus (strain B4) OX=632772 GN=mshB PE=3 SV=1
D1A8M1	4.48e-27	1	205	8	245	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=mshB PE=3 SV=1
Q0S424	7.94e-27	1	232	6	268	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Rhodococcus jostii (strain RHA1) OX=101510 GN=mshB PE=3 SV=1
C1A2R3	4.36e-26	1	242	8	280	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) OX=234621 GN=mshB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999846	0.000182	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_03210.