CAZyme Information: MGYG000001468_03727

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_03727
• CAZy Family: GT2
• CAZyme Description: putative glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		23523.93	9.2696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 916865; End: 917536 Strand: -

Full Sequence      

MGTSADPTVDVVLPCLDEAASLPWVLSRLPAGYRAIVADNGSTDGSAAIAAEHGATVVAV
PQRGFGAAAHAGLEAATADLVCFCDADGSMDPAQLPRVADPVRAGAADLVLGRRRPARGA
WPVHARVANVALARMLRRRTGLRLHDLGPTRAARREALLELGLTDRRFGYPLEMVTAAAD
AGWRIREVDVDYALRTEGSKSKVTGTVLGTVRTIRDMRGVLAR

Enzyme Prediction     

No EC number prediction in MGYG000001468_03727.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	158	2.7e-21	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	3.14e-32	11	178	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06442	DPM1_like	3.06e-22	11	208	1	214	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
COG0463	WcaA	2.87e-15	7	189	3	190	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04188	DPG_synthase	1.03e-13	11	200	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
pfam00535	Glycos_transf_2	4.15e-12	10	158	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG37774.1	2.01e-119	10	223	3	217
QXG75956.1	2.66e-119	2	223	3	225
CCH86606.1	4.72e-118	10	223	13	227
QUW92557.1	3.66e-101	1	222	1	221
AZM76597.1	1.16e-100	3	222	6	224

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY0	3.27e-67	5	222	2	218	Uncharacterized glycosyltransferase MT0564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0564 PE=3 SV=1
P9WMY1	3.27e-67	5	222	2	218	Uncharacterized glycosyltransferase Rv0539 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0539 PE=1 SV=1
P0A598	3.27e-67	5	222	2	218	Uncharacterized glycosyltransferase Mb0553 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB0553 PE=3 SV=1
D4GU74	3.00e-11	7	192	44	240	Low-salt glycan biosynthesis hexosyltransferase Agl6 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl6 PE=3 SV=1
C5CBV8	4.27e-11	12	223	6	233	Undecaprenyl-phosphate mannosyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) OX=465515 GN=Mlut_12000 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000015	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_03727.