CAZyme Information: MGYG000001469_02660

Basic Information

• Species: Neobacillus jeddahensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus jeddahensis
• CAZyme ID: MGYG000001469_02660
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219		24970.49	9.3193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001469	4762944	Isolate	not provided	not provided

• Gene Location: Start: 15209; End: 15868 Strand: +

Full Sequence      

MKKRRRKKFKTFFVLFLLFIALAMFQTYFQHQKRTSLLDNHDPFIEVKKYSPLIQAELAK
YQLESHTSLLVALMQQESGGKGGDPMQASESAGLARNSITDPKQSIEVGVLHFQRILTYG
NERQVDFPTIIQAYNMGSGYIDYVAQHGGKHSEELAKEFSLLQVQKQPTLYTCGGDKNNF
RYPYCYGDFTYSTKVNKNLQLLGDSIPVINNEKTSGEAF

Enzyme Prediction     

No EC number prediction in MGYG000001469_02660.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	3.74e-75	50	200	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	1.44e-60	46	199	3	165	Lysozyme-like.
pfam01464	SLT	2.43e-06	54	139	1	97	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.76e-06	68	152	2	93	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	6.62e-04	24	141	241	371	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ40799.1	1.44e-116	1	219	1	219
QIZ06243.1	7.30e-112	1	219	1	218
AZU60237.1	2.40e-101	1	219	1	219
AZV42625.1	2.48e-87	17	219	28	231
QOS92844.1	1.74e-86	1	206	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	9.75e-23	46	160	25	138	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.55e-17	46	212	23	193	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34636	2.83e-61	1	218	1	223	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P96645	1.29e-24	46	166	56	173	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q99ZN9	8.89e-23	41	202	24	193	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	1.25e-22	41	202	24	193	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	1.25e-22	41	202	24	193	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987811	0.010618	0.000810	0.000048	0.000033	0.000695

TMHMM  Annotations     

start	end
12	29