CAZyme Information: MGYG000001470_00783

Basic Information

• Species: Virgibacillus kapii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus kapii
• CAZyme ID: MGYG000001470_00783
• CAZy Family: CBM50
• CAZyme Description: D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		37422.24	10.0491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001470	4353177	Isolate	not provided	not provided

• Gene Location: Start: 830769; End: 831839 Strand: -

Full Sequence      

MANKKIIMTVTAGAAIAASIVAAEEADAASYKVKSGDSLWTIAQKYNTSVSQLKSINHLS
SDLIFPNQIIETDKKGSSSNSGSSNSSNNNSSNSSSTYTVKRGDTLSGIASKHNISLSNL
MKWNNLNSTLIYPGNVFVVSKNGSSSNSSNNSSSNSGSGSSGSGNSASKTYVVKSGDSLS
VIAGKHGVTVANLKKWNNLSSDLILIGQKLSIGSSSGSSSSSGSGGSSSEKPSNVSYNVD
KLIQTAKSYEGVGYVWGGSSPSGFDCSGFIYYVYKKAGMSISRTSSDGYYNRSYHVSKPK
VGDLVFFAGTYRPGISHLGIYLGNNQFIHAGSSGVQISSLSNPYWSKHFDSYKRFY

Enzyme Prediction     

No EC number prediction in MGYG000001470_00783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	98	139	8.3e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	6.51e-39	251	354	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK06347	PRK06347	7.51e-37	26	241	328	554	1,4-beta-N-acetylmuramoylhydrolase.
COG0791	Spr	3.33e-33	238	353	74	197	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	7.91e-33	27	212	404	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK13914	PRK13914	2.06e-31	97	354	201	480	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
API92963.1	1.75e-157	1	356	1	367
AVR00362.1	4.04e-157	1	356	1	361
QTY15227.1	5.73e-157	1	356	1	361
QRZ18338.1	5.19e-156	1	356	1	354
AUJ23665.1	8.05e-153	1	356	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CFL_A	1.32e-19	240	354	15	136	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
4HPE_A	1.58e-19	241	348	189	299	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	9.65e-18	239	354	191	309	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
2K1G_A	1.13e-17	238	354	2	122	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
4XCM_A	1.54e-16	167	354	1	229	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	6.06e-74	4	355	2	334	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	1.14e-69	30	349	89	407	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
O07532	5.30e-69	30	356	175	488	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q49UX4	2.91e-35	3	216	2	197	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q6GJK9	2.53e-32	3	212	2	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.585531	0.412408	0.000965	0.000479	0.000284	0.000336

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001470_00783.