CAZyme Information: MGYG000001470_00937

Basic Information

• Species: Virgibacillus kapii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus kapii
• CAZyme ID: MGYG000001470_00937
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41228.72	5.3967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001470	4353177	Isolate	not provided	not provided

• Gene Location: Start: 1013520; End: 1014617 Strand: +

Full Sequence      

MGKLRIGIAGTSRGSHFHEDFSKVDGAEVVAIMDPDKRARQAFCDKYQVEYALASYEDLL
NAGIDVVVIASPLQLHAAQAIDALNQDIHVLSEVTAAATLEDCKLLLQAAKNSNAQYMMA
ENYCYIRENIAIRNMVRAGLFGDIYFAEGEYLHNVTYLHYDEHGKPTWRRKETMGKRGCT
YGTHSLGPPLDWFNERVKLVNCLGPGSHTEPAYENDDTTMMLCRTESGALITIRLDMVSN
RPHNMGYYSLQGTKGCYEAPRVPGGTHRIWLTDYTQSKEEWLALPDVYGDFLPAELIDFP
EEAKDSHHWGADYFMVKDFVHRILEQRPVAIDIYKSLEMTLPGILSEQSITRNGAPIEVP
DVRKW

Enzyme Prediction     

No EC number prediction in MGYG000001470_00937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	363	2.6e-84	0.9724310776942355

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.09e-39	1	352	1	337	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.56e-21	4	120	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW35532.1	1.78e-108	4	363	3	369
AEE96970.1	6.52e-107	4	363	2	362
QHT62446.1	3.11e-104	4	364	3	371
QHW33651.1	1.25e-103	4	364	3	371
SDS64700.1	3.04e-102	4	365	6	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.31e-27	3	365	20	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6O15_A	1.63e-10	4	324	2	322	Crystalstructure of a putative oxidoreductase YjhC from Escherichia coli in complex with NAD(H) [Escherichia coli K-12],6O15_B Crystal structure of a putative oxidoreductase YjhC from Escherichia coli in complex with NAD(H) [Escherichia coli K-12]
3Q2K_A	2.92e-09	3	255	30	279	Crystalstructure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]
3E18_A	6.69e-08	3	255	5	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3NTO_A	2.68e-07	4	108	3	111	Crystalstructure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis],3NTQ_A Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTQ_B Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTR_A Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis],3NTR_B Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01S58	5.32e-36	2	365	41	432	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
A8H2K3	9.41e-35	1	361	50	439	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
B1KNF7	2.00e-33	1	361	54	450	Glycosyl hydrolase family 109 protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=Swoo_1749 PE=3 SV=1
Q0HKG4	6.52e-33	1	361	52	442	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1
Q0HWR6	6.52e-33	1	361	52	442	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_1440 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999980	0.000065	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001470_00937.