CAZyme Information: MGYG000001470_01640

Basic Information

• Species: Virgibacillus kapii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus kapii
• CAZyme ID: MGYG000001470_01640
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000001470_1|CGC29	22671.68	7.3898

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001470	4353177	Isolate	not provided	not provided

• Gene Location: Start: 1753921; End: 1754541 Strand: -

Full Sequence      

MEMRDLQQVMQYQAMSVLASNTNGFSNYSPMIDLAFKQMLTEQLTKATNLQAAKQHLLPT
AQNNMISQMSKPATTQDKTNANLAIHQLIADAAATYQLDEKLIYSVVQTESNFNPNARSN
AGAQGLMQLMPATAKALGVTNPYDAEQNINGGAKYLSQMIKRYNGNVELALAAYNAGPGN
VDKYHGIPPFQETQNYVTKVMHSYLT

Enzyme Prediction     

No EC number prediction in MGYG000001470_01640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	101	204	2.8e-35	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.19e-53	100	204	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.86e-48	86	204	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.75e-47	83	204	4	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	5.17e-38	91	181	3	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.33e-36	92	196	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRZ17650.1	1.55e-88	1	205	1	204
AUJ26037.1	9.36e-86	1	205	1	207
API90798.1	3.14e-83	1	205	1	203
QTY17485.1	3.14e-83	1	205	1	203
AVQ99582.1	3.43e-79	1	205	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.21e-15	93	201	424	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.21e-15	93	201	428	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.21e-15	93	201	434	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.22e-15	93	201	438	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.22e-15	93	201	444	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.51e-47	80	204	55	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.54e-41	89	204	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.54e-41	89	204	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.33e-23	87	201	9	116	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q3IHZ1	1.30e-15	98	182	292	382	Membrane-bound lytic murein transglycosylase F OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001470_01640.