CAZyme Information: MGYG000001471_00154

Basic Information

• Species: Bifidobacterium gallicum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium gallicum
• CAZyme ID: MGYG000001471_00154
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000001471_1|CGC3	57013.13	4.4863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001471	2004594	Isolate	not provided	not provided

• Gene Location: Start: 196273; End: 197874 Strand: -

Full Sequence      

MAKSWSPHRLTVLRRIRVATVAVAVTLASCIAFGVSTRKAVALSVNGETTHVTTYATSIY
ALLEEQGIQVKTHDIVTSDSPDGLVDHATITVNSAYQTTISIDGQEVPFWTVADSAEQLI
GFFEANNVDASRISVDINNIYNRLTGGIVINANGPVTVIADGKSSIVENGNLPAASILDA
KGITLGKEDRVSVHKDGTTTILRVERVTHDQIEEHEPIAYQTRTIVDPTLQPGQTRVEQP
GVEGERTTTYRVTYVDGHEENRTVLSQQITKTPIDAIVAIGPEPEPEPEPSPSASDNTSG
DNGDNSNSNDTAEADGNGTDTGNTQSSTGENNTDDNNDGTSNTPDGDDQDNPSPQATPTP
SQSATSAPEPSASPSATTKPTPTPTPTQTATPKPTPTTPAKPTPTPQPQPQPSDPDAQAR
AGSRLFRPSVSAAQAYAAGAAAQRGWTGKNWSDLVQLWNHESGWRWNAQNPTSPAYGIPQ
CYFPENMAAYGKYYRDDAAAQIDWGLAYIAGRADYGSPSKAWQLWQSRNPHWY

Enzyme Prediction     

No EC number prediction in MGYG000001471_00154.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	2.09e-42	16	308	15	309	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	1.51e-23	211	281	3	73	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	1.09e-06	41	77	1	37	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd13925	RPF	1.37e-04	459	503	8	54	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam03990	DUF348	0.001	156	196	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATU19951.1	2.40e-144	1	533	1	516
ATO39418.1	1.51e-142	1	533	1	494
AIZ16948.1	2.18e-141	1	533	1	512
AXR42445.1	8.42e-140	1	533	1	507
QHB63546.1	8.42e-140	1	533	1	507

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	1.39e-15	6	267	2	273	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
P37546	1.20e-08	37	281	36	283	Putative cell wall shaping protein YabE OS=Bacillus subtilis (strain 168) OX=224308 GN=yabE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011084	0.399689	0.585312	0.002568	0.000966	0.000368

TMHMM  Annotations     

start	end
13	35