CAZyme Information: MGYG000001471_00502

Basic Information

• Species: Bifidobacterium gallicum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium gallicum
• CAZyme ID: MGYG000001471_00502
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711	MGYG000001471_3|CGC2	79764.13	7.1741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001471	2004594	Isolate	not provided	not provided

• Gene Location: Start: 77550; End: 79685 Strand: +

Full Sequence      

MPHAQQSLKNGTTAGNQSAASKAAKAAKASKASKAPKASNKPDETWQVVNRVVYPVRDED
LTMPLYCIEWTRPHLTDAVLDPRVDTRALNFKAMNKTTFQRLVGEGVNPHANTAQHDVFS
TLGRTGLRIQPGQHVSLCTFFNAFPASYWRRWTNITAVRFVACVQGHGQITLFRSTGRGL
FSPAGTIAVDCEEPTTVTSDLDLHGLMDGGYFWFDAKASESDSLTVSDAAWSVPVADRTA
QESTTLSIAITTFNRAPYCMNQLKAISAEAPLRARLDTIFCTDQGTDLVKDQPDFDQVAD
ELGPQLTYIRQANFGGSGGFSRGMYETLKAGTSSYTLLLDDDAISEPESILRAVQFADYC
KKPTIVGGGMLHLDNRTVLYTQGERFTRNSVWMAPSDGLPYNHDFAAFPLRDSPERHRRV
DSDFNGWWMCLIPTAIMKDIGLSLPVFIKFDDTEYGLRALEHGYHTVCLPGVAVWHQAWH
DKDPSRTWEEYFFQRNRWICALLHEPKPSLRFMYEMFYGDVNVGLKFVYSALKLRHMGLR
DIMRGPQYIVDSMPGKLAEVREARQGFADTTMLTDRDALPEPRREFSDDFKPESFSATKI
SGLVAITKALLSRGDGTVDTQPDIAIPARDAFWRSYDGINSAVVTSPDGSSIAWCRRDSK
EYRKQIKRGLFLSNELRKRWEQLSEQYRAYDMASVAVWQRIFESGAAKPAQ

Enzyme Prediction     

No EC number prediction in MGYG000001471_00502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	245	501	9.2e-50	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	6.44e-34	245	501	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG1216	GT2	4.91e-26	246	562	5	303	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam17994	Glft2_N	7.48e-24	122	234	33	140	Galactofuranosyltransferase 2 N-terminal. This is the N-terminal beta-barrel domain found in the polymerizing galactofuranosyltransferase GlfT2 (Rv3808c). This enzyme synthesizes the bulk of the galactan portion of the mycolyl-arabinogalactan complex, which is the largest component of the mycobacterial cell wall such as in Mycobacterium tuberculosis. The N-terminal domain contains two short helices preceding a 10-stranded beta-sandwich with jelly roll topology.
COG1215	BcsA	5.11e-07	275	498	84	280	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04185	GT_2_like_b	9.67e-07	418	497	115	199	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTL79537.1	0.0	44	704	23	684
VEG24589.1	0.0	44	703	23	683
BAQ27918.1	0.0	44	703	23	683
ADB10612.1	0.0	44	703	13	673
QTL77684.1	0.0	44	704	23	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	2.06e-111	124	688	63	630	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R628	1.21e-114	124	688	54	620	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1
O53585	6.56e-111	124	688	43	610	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001471_00502.