CAZyme Information: MGYG000001473_00267

Basic Information

• Species: Anaerosalibacter massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Sporanaerobacteraceae; Anaerosalibacter; Anaerosalibacter massiliensis
• CAZyme ID: MGYG000001473_00267
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		33386.29	9.4445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001473	3196506	Isolate	not provided	not provided

• Gene Location: Start: 84543; End: 85403 Strand: -

Full Sequence      

MAKNKTVYRFFNIIPISLFIMLIVLGKNGNVGISSEKNSLVDKKKLIPILMYHHVGKEGV
EVNKITITNKRFEEDMKYLKDNRYTPIFFNELVSYEENGTSLPEKPVIITFDDGLEDNYK
YAYPVLRKNNMKATIFTIGSRIGIRNFNNDTRYSYFTWKEGKEMYESGIVEIQPHSYDLH
NYKENSKHGVGVLPMSREDEDLHYDRFSKDTVQVMKLIKENIGCDSYVYAYPYGKYNSTN
ERVLKDLNFKVTLTTKSKYADISNGLYELKRINVPSHKKLNQLLIN

Enzyme Prediction     

No EC number prediction in MGYG000001473_00267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	100	254	1.6e-26	0.9461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10969	CE4_Ecf1_like_5s	4.67e-44	70	277	2	205	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	5.48e-42	106	277	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10966	CE4_yadE_5s	1.46e-41	103	283	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
PRK14581	hmsF	2.68e-31	49	286	51	307	outer membrane N-deacetylase; Provisional
cd10965	CE4_IcaB_5s	2.12e-27	103	274	1	159	Putative catalytic polysaccharide deacetylase domain of bacterial intercellular adhesion protein IcaB and similar proteins. The family is represented by the surface-attached protein intercellular adhesion protein IcaB (Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase, EC 3.5.1.-), encoded by Staphylococcus epidermidis icaB gene from the icaABC gene cluster that is involved in the synthesis of polysaccharide intercellular adhesin (PIA), which is located mainly on the cell surface. IcaB is a secreted, cell wall-associated protein that plays a crucial role in exopolysaccharide modification in bacterial biofilm formation. It catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. IcaB shows high homology to the N-terminal NodB homology domain of Escherichia coli PgaB. At this point, they are classified in the same family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS79569.1	1.28e-125	20	284	7	268
ASF40455.1	1.77e-64	47	284	210	449
CCG46444.1	1.77e-64	47	284	210	449
ARI76505.1	1.28e-61	27	286	206	472
AFS77609.1	1.36e-48	35	284	10	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	1.46e-25	49	258	39	233	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
3VUS_A	8.04e-21	50	285	11	265	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	7.44e-20	50	285	15	269	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	4.52e-19	50	285	15	269	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]
6DQ3_A	5.41e-19	47	284	9	225	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	2.01e-26	42	274	60	262	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q9RQP7	4.88e-25	8	272	3	269	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaB PE=3 SV=2
Q6G606	4.88e-25	8	272	3	269	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q8NUI6	4.88e-25	8	272	3	269	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q5HCM9	5.07e-25	8	272	3	269	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.842985	0.146439	0.008381	0.000259	0.000207	0.001746

TMHMM  Annotations     

start	end
7	26