CAZyme Information: MGYG000001475_00551

Basic Information

• Species: Neobacillus rubiinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus rubiinfantis
• CAZyme ID: MGYG000001475_00551
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000001475_11|CGC4	47209.4	9.0005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001475	4309569	Isolate	not provided	not provided

• Gene Location: Start: 315359; End: 316534 Strand: -

Full Sequence      

MLMKVKKILIFSYKCLFKLVSILPAKKNLIMFESFLGRQYSDNPRAIYEYMKEHHPEYKC
IWSVDPRFVQGFSDKGVQYAHRFSIKWLFSMARARFWITNSRMPLWIPKPRHTIYLQTWH
GTPLKKLVFDMKDVLIPGTTTDKYKQEFYQESRNWDYLVSPNRYSTEIFKRAFRYEKEVI
ESGYPRNDIFYKPERTQIAERFKGKYKLPQNKKIILYAPTWRDNQFREGNYKLGLHLDLS
MLQKELGEEYIIILRMHYLVAENFDLEAYQGFAFDFSKHEDIQELYLISDVLITDYSSVF
FDYANLKRPIIFYTYDLEEYREDIRGFYFDLKKNAPGPIVKTTEEIMEVLKTESEQSEYT
EQLQQFYQQFCYLEDGHASERVVKAVILKNK

Enzyme Prediction     

No EC number prediction in MGYG000001475_00551.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	6.32e-143	24	388	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	4.44e-115	3	387	1	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN00810.1	9.91e-138	23	389	374	740
AJG93766.1	1.07e-136	23	390	344	713
ALQ70765.1	2.14e-136	23	386	344	709
AJI06556.1	4.29e-135	23	386	343	708
AIY76015.1	4.29e-135	23	386	343	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	7.20e-110	26	382	351	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	7.90e-109	26	382	351	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.20e-108	26	382	351	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	2.05e-165	7	386	361	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	3.88e-156	2	387	6	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	8.86e-124	5	386	6	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	3.24e-109	26	382	351	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	6.06e-40	22	387	252	604	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001475_00551.