CAZyme Information: MGYG000001475_00553

Basic Information

• Species: Neobacillus rubiinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus rubiinfantis
• CAZyme ID: MGYG000001475_00553
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	MGYG000001475_11|CGC4	109204.63	9.2201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001475	4309569	Isolate	not provided	not provided

• Gene Location: Start: 318346; End: 321123 Strand: +

Full Sequence      

MERKVSIIVPIYNVEQYLEDCIQSILEQDNFNFIEVLLIDDGSIDESSVIAKNFAEKYDN
ITYHYKENGGLSSARNFGFNLVTTPYVMFLDSDDKLAPRAVMDLYNLANDTKCPIVIGDL
VTFPAETPKYLWKKYFGKGNFVVNNIFDFPDLIFGPSACNKIFDVEYLRSNNLSFPEGMT
FEDAFAIIPLMLDQHPIAILDEVVYLYRKRDEKTSIMDSIYTKPKNFFDHLKVNEKLYNL
IPENATLLQKEVIFNYIIRTYNGFLTALTNSSKDVLSLEEKSEIFTRLHNMYKNIPLYSF
TKYLTNPTMRLVYFAIIENRFNLFLEPVIKENVLNIKDDKFNFPITRIKTSENFIECSFS
IWIDFVSTDDEEISFYGLIDAPTLGLNKILENKVIFYFENPKMKKIVAETNGEIIRRMDY
KGHEDAQFHGIKFSIPFKIFKKFPESYSELNVKIYDNKTKQSISLKVRAFGLLNRFKGFL
KDNANNNIAYLNIMKDRSIKIRHGKQSIKKLIKAEVNKIFKKSKRRFNVGGKIRLAYWIT
YPFFSKKNIVLIGERRDTFQDNSSHLFRHVRKKHPKADWFYLLDSNSEQFQEANKLGNVI
KIDSIKHYLYLLHAKKIINSYDLESYMIPKGYTKGEYLKRFGDLIKYKRIFLQHGIVYNN
ISSAASRYKTAYDLIVSSNLKETEFFIRDAHFNKKQIIQSGLPRYDRLFNYIRKSPLQHN
EEKQILLMPTWRTTLAKKSYLKKAKQTGATEQEFMESDYYRFYSNILSDKQMEKFLIEHN
ATLNFYPHYEMHDFLHLFKNKNKHVKIIKDKTLKVQDLLIENDVLITDYSSVFFDFAFMR
KPIVFTQFDYEHFYKTQYKEGYFSFANQGLGPVVDNIPDLIKALESIDNNHYQMTNAQQE
FSKQFFDYLDESSICEKIYQQIEKL

Enzyme Prediction     

No EC number prediction in MGYG000001475_00553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	154	2.1e-30	0.8941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	2.55e-38	543	924	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
pfam00535	Glycos_transf_2	8.06e-29	6	168	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1887	TagB	9.71e-29	546	925	25	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd00761	Glyco_tranf_GTA_type	8.00e-26	7	123	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10073	PRK10073	2.60e-23	4	109	7	111	putative glycosyl transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ34299.1	4.54e-214	4	911	3	917
SNW00119.1	2.85e-212	4	925	3	918
AVQ34302.1	3.42e-212	4	925	9	924
SNW00103.1	2.42e-195	49	911	5	874
CAD5931919.1	5.15e-169	4	925	556	1463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	5.81e-25	5	226	7	237	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.37e-20	4	120	6	121	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
3L7J_A	1.11e-16	4	905	3	698	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7I_A	1.46e-16	4	905	3	698	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7M_A	2.54e-16	4	179	3	175	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46918	9.04e-67	6	925	11	893	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
A0A0H2URH7	9.10e-21	1	210	3	218	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P46917	4.52e-20	6	227	3	228	Minor teichoic acid biosynthesis protein GgaA OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaA PE=3 SV=1
A0A0H2UR96	4.86e-18	1	210	1	217	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71059	2.22e-17	5	209	5	213	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001475_00553.