CAZyme Information: MGYG000001475_02435

Basic Information

• Species: Neobacillus rubiinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus rubiinfantis
• CAZyme ID: MGYG000001475_02435
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000001475_23|CGC1	51083.04	9.7055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001475	4309569	Isolate	not provided	not provided

• Gene Location: Start: 31488; End: 32834 Strand: -

Full Sequence      

MNLITSVPTNNPPTLKRFYLPVLWKFWLSHGISLAWMIFSIIISMPWVKELGELISLPGS
IVIITGIAYVPGYLNAFLVVSLLFDRQPTFKISHPQEPVSILIACWNEEKGIVATLQQIA
KQDYQGAMQIYVIDNNSTDNTSEVARLLGKELGLNVTVLFEKKPGKNFALNTGLQYVKTK
HVITLDADTLLHPQAVRRLMARITSAPKEVCAVAGAVLVRNSRENWLARIQEWDYFLGIA
SIKRLQGLYQGTLVAQGAYSVYLTDVVKEAGGWPDAIGEDIVLTWSFLESNHKVYFEPTA
IAFTDVPTGFVHFARQRSRWARGMIEALKKVKPWEHPMVFTRYLTGSNLLMPYLDVVYTF
VWMPGLLLAFFGIFWIVGPHTLLVLPLTLLTNYILYRHQKRVFNELDLHIRRNVGGFLLY
VVGYQMIMAPVSVWGYIQEFMKLQRVWK

Enzyme Prediction     

No EC number prediction in MGYG000001475_02435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	98	323	2e-31	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.64e-52	101	280	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.37e-41	55	437	9	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	8.44e-33	86	370	43	330	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	8.83e-28	72	327	4	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK14583	hmsR	1.21e-27	34	373	6	347	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZU64946.1	3.51e-255	37	448	1	412
AQS57715.1	1.17e-208	6	448	8	448
AOT69674.1	5.89e-207	19	448	21	450
AOT73247.1	7.07e-206	13	448	13	451
AFV11008.1	1.16e-204	16	448	19	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	7.04e-10	148	322	161	345	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	2.87e-09	148	322	161	345	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
5TZE_C	1.73e-06	100	213	4	118	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	2.36e-06	100	213	4	118	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	3.48e-27	63	328	12	275	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	4.76e-27	63	328	12	275	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HCN1	1.71e-24	85	328	36	275	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q9RQP9	1.71e-24	85	328	36	275	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	1.71e-24	85	328	36	275	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
61	83
348	370
374	396
416	438