CAZyme Information: MGYG000001476_01649

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_01649
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		22511.79	8.352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 78978; End: 79577 Strand: +

Full Sequence      

MKHFKRILLACAAAVILLLIGYFALNRGYTFFMKRAYPLQYTQLVAKEATANRLDPALVY
SVIKAESNFDPNARSHAGAVGLMQMTPDTFEWVQTKLKSDTKYEEEDLYAPDINIRYGCK
LLALLFERYSEKATALSAYNAGIGTVNTWLKNPDISKDGAVLDSIPYEETRNYVDAVLKN
YANYKKLYQFNSKGETIDG

Enzyme Prediction     

No EC number prediction in MGYG000001476_01649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	187	2.3e-32	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.02e-64	38	181	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.23e-51	36	187	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.40e-36	56	182	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	2.67e-31	45	181	3	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	7.19e-30	36	188	134	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY33915.1	2.02e-104	1	198	1	198
CAB1248982.1	3.56e-67	2	190	11	197
QAT49510.1	6.49e-63	1	189	1	187
QNK41497.1	6.07e-59	2	189	8	189
CAB1246558.1	5.49e-53	5	188	15	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.07e-18	37	182	445	589	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.11e-18	37	182	474	618	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	7.70e-18	37	182	446	590	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	7.70e-18	37	182	445	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5O1J_A	1.03e-17	45	188	424	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.72e-16	33	185	472	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	9.12e-16	33	185	472	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	9.12e-16	33	185	472	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	2.29e-14	36	182	1417	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.29e-14	36	182	1417	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999900	0.000025	0.000073	0.000000	0.000000	0.000045

TMHMM  Annotations     

start	end
7	29