CAZyme Information: MGYG000001476_02053

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_02053
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		46688.26	7.2032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 5450; End: 6703 Strand: +

Full Sequence      

MKDCLVLLTKTFPFDKGEEFIEDELPLLAKAFDQVIIVATSTADNPVQTRSVPENVCVHN
IRASKVKRSLAGAVARQFPFKDYKGYSGKDERNAVKGSLKKNLYLSYFIAKSEIVYDETV
KILAPYSLQQYDGVTFYSYWFYDIAMAAVRLKRYCQAKAKLAVCRAHGYDLYAYRNSMNY
LPLRHYLLKNIDKVYTCSQDGNDYLTGLYPQYAGKIQTAYLGTRDYGTTESDGTGPFQIV
SCCHIVPLKRVDLLAKSLSLLNGSGLALKWTHFGGGDALEELKKYAEENLRFLEYDFRGE
VKNSDLMAYYQNTPVDLFVNTSSTEGLPVSIMEACSFGIPAVATNVGGTGEIVRDGETGF
LIEADFTSDKLASAIRSVAELPAEERKKLRENCRSVYLSTFCAQDNFAAFAQQIKPL

Enzyme Prediction     

No EC number prediction in MGYG000001476_02053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	237	386	1.4e-23	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04946	GT4_AmsK-like	3.37e-103	4	412	1	401	amylovoran biosynthesis glycosyltransferase AmsK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmsK is involved in the biosynthesis of amylovoran, which functions as a virulence factor. It functions as a glycosyl transferase which transfers galactose from UDP-galactose to a lipid-linked amylovoran-subunit precursor. The members of this family are found mainly in bacteria and Archaea.
cd03801	GT4_PimA-like	2.39e-32	144	404	92	355	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.13e-27	126	414	79	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.30e-26	235	396	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03808	GT4_CapM-like	4.52e-23	159	404	100	351	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34424.1	3.45e-230	1	417	1	417
AJF30737.1	2.28e-185	1	415	1	415
ACD53904.1	2.28e-185	1	415	1	415
AJF33800.1	2.28e-185	1	415	1	415
AIY82178.1	1.82e-182	1	416	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XYW_A	1.90e-08	249	363	192	292	GlycosyltransferasesWbnH [Escherichia coli]
2F9F_A	5.13e-07	240	387	27	168	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY8	3.22e-08	186	390	163	367	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1
P9WMY9	3.22e-08	186	390	163	367	Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
P0DMP6	1.04e-07	249	363	192	292	O-antigen biosynthesis glycosyltransferase WbnH OS=Escherichia coli OX=562 GN=wbnH PE=1 SV=1
P0DMP7	1.04e-07	249	363	192	292	Probable O-antigen biosynthesis glycosyltransferase WbiN OS=Escherichia coli OX=562 GN=wbiN PE=3 SV=1
O05083	8.23e-07	239	363	184	305	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001476_02053.