CAZyme Information: MGYG000001476_02287

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_02287
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000001476_14|CGC1	46246.31	8.8033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 102495; End: 103742 Strand: -

Full Sequence      

MKFTIVTIGSRGDVQPFLALGKGLQDRGHRVRICAMHVFQDVIEKEGFEYAPMAGDAREV
MRRLIGEQVSSFEYFSNLKYLLNPVKEEFLSNMETACTGADAILYSLLGSVAYHVGEKLK
IPCFRVPFCPVDPTGEFPAMTAPLLPLGRAYNRLTFRGGDLLWSNATRSLLNDWRSEMGL
RKIRLFEFPYRRMNGETIPTLYPFSPVLVPKPKEWSKDCYLTGFWIRESTENWAPDEKLA
NFLSNGTKPVYIGFGSTVGGNFDRILHIVLESIANTGQRALLSSGWRSLKGVKLSDNVMQ
IGNIPHEWLFKRMAAVSHHGGAGTTAAGVRAGVPSVIVPFGGDQPFWGNRLFELGIGTKP
IWTKELTVENYSNAIMEAVGNHSMKEKAAQIGERLRAENGVHTAVEIIEKILADK

Enzyme Prediction     

EC	2.4.1.173

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	6	412	2.2e-54	0.9921465968586387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.39e-66	1	411	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	3.42e-57	1	415	2	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	1.20e-18	8	413	3	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	4.48e-12	3	138	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
PHA03392	egt	8.37e-12	236	412	284	465	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT62528.1	4.17e-188	1	409	1	409
QAT48736.1	6.50e-130	1	409	65	470
CAB1252917.1	9.69e-122	1	378	1	378
AFZ29125.1	1.15e-107	1	412	1	405
BAY41773.1	2.62e-107	1	412	1	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.97e-71	2	408	21	435	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.22e-71	2	408	41	455	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.47e-40	1	357	1	346	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	8.38e-38	1	411	1	381	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	5.86e-32	1	357	1	347	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B4C9	6.45e-81	1	412	896	1313	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1
Q6C8M8	1.86e-80	1	412	995	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
A7KAN4	5.78e-78	1	412	884	1301	Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=atg26 PE=3 SV=1
Q4WID6	1.56e-77	1	412	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
Q2U0C3	2.79e-77	1	412	892	1309	Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001476_02287.