CAZyme Information: MGYG000001477_01540

Basic Information

• Species: Clostridium_L amazonitimonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_L; Clostridium_L amazonitimonense
• CAZyme ID: MGYG000001477_01540
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001477_7|CGC10	43377.06	7.5265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001477	3750216	Isolate	not provided	not provided

• Gene Location: Start: 761238; End: 762356 Strand: -

Full Sequence      

MRYGMQYLKTENVHLIKDMGMIPYKLFKRHGFQSSVITYENGEYPYLNKEVRGLNINFAK
KFFHSFSLDGAVYLIKHAKEYDIIQIFHTTLSSVIYAYIYKAFNPKGKIYLKLDCSHKLV
ERIRGLNALSYRFLNKFFSKIDLISVEQEALYPKIKELLPRQQHKIIKVSNGVDYDYIET
LNLEYDFSKKENIILNVARIGAEEKNTSMLLEAFANIKDIEKTDWKLVLVGPVEKNFESY
ISDYFAKYPKIINKVIIKGNIDDRRELYMEYQRSKIFSLTSDFESFGIAFIEAAAFGDVI
VATDVGIAKEIVGDNNGRLVPVGDVNTLTKALEESIYNLDLEYISNKTYELTKEKYDWNK
IIDYLHEELVKI

Enzyme Prediction     

No EC number prediction in MGYG000001477_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	187	338	2.9e-27	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.17e-35	24	369	24	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	6.54e-29	17	342	16	332	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	2.35e-26	24	372	25	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	4.91e-26	74	334	71	325	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
pfam13692	Glyco_trans_1_4	5.85e-26	191	334	1	134	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPW56947.1	9.20e-156	1	371	1	371
QPW59691.1	9.20e-156	1	371	1	371
AEB75693.1	1.23e-153	1	371	1	371
QPW52378.1	1.11e-152	1	371	1	371
AYF55115.1	1.11e-152	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MI0_A	1.04e-08	105	315	112	331	ChainA, Glycosyltransferase [Rickettsia africae ESF-5]
6N1X_A	1.28e-06	146	338	143	344	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	1.34e-06	146	338	159	360	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
4N9W_A	4.10e-06	167	361	168	356	Crystalstructure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_A Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_B Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_C Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_D Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155]
2GEJ_A	4.23e-06	167	361	184	372	CrystalStructure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP-Man [Mycolicibacterium smegmatis MC2 155],2GEK_A Crystal Structure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07147	1.66e-06	167	361	164	352	Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=pimA PE=3 SV=1
A6LKE9	7.66e-06	151	360	202	398	Probable sucrose-phosphate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) OX=391009 GN=Tmel_0533 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001477_01540.