CAZyme Information: MGYG000001477_02230

Basic Information

• Species: Clostridium_L amazonitimonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_L; Clostridium_L amazonitimonense
• CAZyme ID: MGYG000001477_02230
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000001477_7|CGC13	26399.92	9.9184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001477	3750216	Isolate	not provided	not provided

• Gene Location: Start: 1479239; End: 1479922 Strand: -

Full Sequence      

MKKKRSFIILLFLFVLVLTASTTKYYDNKYNIDSNIIENLKLEKQNYVTIDRMPKDLKRA
VILMEDKRFYKHGGYDVKAITRALIADIKARKIVQGGSTITQQLAKNLFLSEDQSLKRKI
DELFLSIKLEKVYSKEEILEMYLNIIYYGDGAYGVQEASNKFFNKNIWELSIEECAMLAG
IPQAPSLYNPKDNLEKAKSRQRFVLKLLDKNKDMVISRVVNMNFVEA

Enzyme Prediction     

No EC number prediction in MGYG000001477_02230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	35	207	2.3e-69	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.02e-89	33	208	1	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	7.98e-84	47	205	4	162	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.44e-79	22	208	55	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.57e-75	30	206	52	228	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	9.00e-50	48	211	69	233	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30607.1	3.29e-72	4	211	6	214
QZY53689.1	1.42e-71	1	211	1	211
BCN29359.1	7.52e-64	27	211	27	211
QUI24324.1	7.53e-61	30	210	33	213
QSX08343.1	3.45e-54	30	206	45	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	9.20e-54	42	206	17	181	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.69e-53	42	206	17	181	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.26e-38	35	189	46	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.32e-38	35	189	10	171	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.36e-38	35	189	11	172	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	5.42e-49	30	206	48	224	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	1.56e-45	37	209	59	231	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87626	3.40e-45	30	205	53	228	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	1.18e-44	23	210	73	261	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q07259	4.79e-44	46	205	48	206	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.097476	0.311400	0.589717	0.000410	0.000373	0.000612

TMHMM  Annotations     

start	end
7	26