CAZyme Information: MGYG000001477_02629

Basic Information

• Species: Clostridium_L amazonitimonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_L; Clostridium_L amazonitimonense
• CAZyme ID: MGYG000001477_02629
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000001477_7|CGC18	32534.49	9.2244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001477	3750216	Isolate	not provided	not provided

• Gene Location: Start: 1947890; End: 1948741 Strand: -

Full Sequence      

MSVTIICPLYNAESYLENLDNSLKMQKNVHIDQIKYILTESKDNSEAILKSLGSDYKLIT
KGEFSHSKTREQAALEASGDILVFITQDIIIKDELWLYNLTKDIREGNCEGAFSRQICDN
NTIEKYIRENNYPGVSRTVSKEDIPKLGLMTFFFSDASSAIKKSVFVELKGYDAKDLIIS
EDMYIAHKMIMAGYRIKYCAESKVIHSHKFTLKQLYRRYNDTGRFFKENSYLKQYGANES
GFKLLKYVLKRAFQEKNFAVIFNVIPNFAARFIGMKLGQKGIG

Enzyme Prediction     

No EC number prediction in MGYG000001477_02629.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.80e-10	2	219	1	220	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04186	GT_2_like_c	4.35e-08	5	208	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	5.38e-08	3	204	56	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	5.64e-08	1	262	3	279	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	1.82e-07	5	196	1	154	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWZ49463.1	1.28e-132	1	282	1	282
QAT40507.1	5.78e-128	1	280	1	280
ACD23207.1	1.14e-116	1	280	1	282
CDH92141.1	1.30e-116	1	280	5	286
AJF30794.1	1.07e-114	1	280	1	282

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	9.93e-41	1	279	1	282	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001477_02629.