CAZyme Information: MGYG000001479_02374

Basic Information

• Species: Clostridium_AA polynesiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_AA; Clostridium_AA polynesiense
• CAZyme ID: MGYG000001479_02374
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027	MGYG000001479_122|CGC1	117891.65	5.6201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001479	3560738	Isolate	not provided	not provided

• Gene Location: Start: 11948; End: 15031 Strand: -

Full Sequence      

MKEPKVSFIIVNYNGKHHLKECFETIYDLDYPKEKLEIVMVDNGSKDGSIEFVKKNFSKV
KIIKNESNLGFAKPNNQGAAIAEGEYLALINNDMRVNKDWLRTMLKTLEDAGDESYACVG
SKILNWDGTKLDFAGGAVNFMGFGYQDDYGMPIKEANSKYNTDRDILFACGGALLIDKKV
FLEIGGFDEDYFAYYEDTDLGWRLWVLGYKVRFSANSICYHKHNSTSKSFNQNKMKALFE
RNALFSIYKNYSNDNFNIILSSILLAANRLQKDLNINGEAYDIKSMESPEQIVNCDDENF
TTLVALNELLKNISVMSKKREFIQSNRKVRDEDLAHLFTRPLLPFPLKYFHDFEYLKNIQ
SIMDTFKVDKVFNTKFRRKILLIAGDKVGKKMAGPGIRYWEFGKQLAVDNDVVLAVPNPV
SPEMNSAYLTLIEYNPQAPQSVASLANDSDIIILHGTIMEQVPELKDTSRNKVLIVDIYD
PFVIENLEIYKNKDMRIRVADNEITSKVQIDQLELGDYFICASEAQMNFWIGMLAALRKI
TPEEYDLSSDLSKLIGSVPFGISVEEPKHTRSAMGEKVGNLKPEDKVFIWGGGIWNWFDP
LTIIKAIYEISKERDDIKLFFLGVKHPNPAVPEMEMTNKAIELAEELGIKDKYIFFNMDW
VDYEDRQNFLLESYGGVSCHFKNLETRFSFRTRILDYLWARLPIIATEGDYFASEVEKHN
LGLVVGYENTEDMKNALIKLCDDKEFYENCRANIDTYRENYKWDKVTKPLIDFCNNPVKK
SLSRNLESFWDIEQAAKDSVTGEFTNKEKIGQKFRCRYPNLTAVEVFIATYKRTNNHMLN
FKLFDAATDILVAEKEFNALDLVDNTWINITFDPILNSEGRDFYFYFESQGASEGNSITL
WKSSSENAYGSIWKDGELESGNLTFRTEVIFSIKPLAAGITLPDISGNNNPLSQLSMEEL
HKIINNARVVRKTGTGVNSAELGEMKRCISDLLINVNNINSWIQNRNKRLRIVKKPVSLL
KKLFRRK

Enzyme Prediction     

No EC number prediction in MGYG000001479_02374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	7	244	7.3e-25	0.823728813559322

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	3.06e-62	2	270	1	268	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	3.02e-54	9	223	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03794	GT4_WbuB-like	2.78e-27	379	771	1	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd02525	Succinoglycan_BP_ExoA	2.92e-26	5	230	1	216	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1215	BcsA	1.79e-23	2	220	52	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA51766.1	0.0	1	1026	1	1042
AOZ75075.1	0.0	1	1026	1	1042
AOZ78870.1	0.0	1	1026	1	1042
AEI32282.1	0.0	4	1026	5	1044
ADZ21378.1	0.0	4	1026	5	1044

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	4.45e-12	2	241	11	223	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5TZE_C	6.34e-09	5	102	2	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.06e-08	5	102	2	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
6YV7_B	2.36e-07	4	219	42	244	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.37e-07	4	219	43	245	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYG7	8.81e-12	4	221	6	208	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
D4GYH2	1.12e-10	4	237	7	223	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
D4GYH3	7.81e-09	5	190	2	178	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1
Q50864	9.29e-09	4	228	574	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	1.33e-08	9	228	8	243	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001479_02374.