CAZyme Information: MGYG000001479_03289

Basic Information

• Species: Clostridium_AA polynesiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_AA; Clostridium_AA polynesiense
• CAZyme ID: MGYG000001479_03289
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		50785.82	9.633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001479	3560738	Isolate	not provided	not provided

• Gene Location: Start: 10760; End: 12085 Strand: +

Full Sequence      

MNKEASIKDNIYIPVKLKFQIAFLLSVIWVIFSVYLSQSWIKDLAEVTNVFTSLFIIGGI
AYVPGFINCFLLISVLLDKQPVFKEEDPYEEVTILIAAYNEEDRIYETLSYIKKQDYKGK
IRTLVINNNSSDNTRGEAERAGRELGLDVICIDEKTPGKFNALNTGLKEVKTPLFITLDA
DTLLHSKAVRYIVSRVISAPQDIGAVAGSVLVRNSRDNLLARLQKWDYFLSIMSIKRIQG
LFQGTLVAQGAFSIYKAELVRELGGWSDSIGEDIVLTWNMLFKNNKVYYEPMAIAFTDVP
TKFTHFVKQRSRWARGMIEGLRVVKPWQIPNMYYKFLTSVNLLIPYMDLSYTIFFIPGCI
LALFGRCYIVGPLTLLVLPFTLITFLILFYRQKHFFDILNLRVRKNKAAFVIFLLGYQLI
MSPISLWGYMQEIFNMKRVWK

Enzyme Prediction     

No EC number prediction in MGYG000001479_03289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	92	316	6.7e-26	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.06e-51	94	273	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	7.63e-41	40	430	1	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.08e-36	50	363	19	330	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	5.10e-32	71	320	10	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK14583	hmsR	5.56e-29	92	427	77	412	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEG59859.1	2.44e-188	2	441	14	453
QOK29384.1	8.36e-186	8	440	16	449
AIE60039.1	1.74e-185	8	441	17	451
AHM57960.1	4.47e-185	10	441	17	448
AND40888.1	3.18e-183	8	440	16	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	3.47e-15	86	316	108	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.45e-14	86	316	108	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
5EJ1_A	6.31e-07	80	326	120	384	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	6.52e-07	80	326	132	396	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	6.52e-07	80	326	133	397	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6G608	7.31e-33	77	351	35	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	7.31e-33	77	351	35	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q6GDD8	2.63e-32	77	351	35	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q9RQP9	2.63e-32	77	351	35	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q5HCN1	2.63e-32	77	351	35	310	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40
55	77
342	364
368	390
409	431