CAZyme Information: MGYG000001480_00594

Basic Information

• Species: Pauljensenia polynesiensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia polynesiensis
• CAZyme ID: MGYG000001480_00594
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000001480_78|CGC1	65442.25	8.6222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001480	2878449	Isolate	not provided	not provided

• Gene Location: Start: 8637; End: 10415 Strand: +

Full Sequence      

MNTPPDSPSPLPPPERGSTLEDFEKLLATTARQTPGPGTGTFAHDHPGDALAAVVDGGDL
TGRHEETTRTRGPSPSLMALVLLATMGVIAYAAFLLNPAHRGDMLPYLLIVVAEAVVILN
ALLAMWTILSSGYDPHDSSFHHASNHLFDPEEIVREGIQDRPELWPMHLGGRPVTVEVFI
TTYGEPVDVLRRTVVAALAMKGAHRTWILDDGRSDEVAALARELGARYVRRPTSNGAKAG
NVNYALTLAKGPLFAILDADFVPRPDMLTEMVPFFADRTAAFVQGPQVYGNMDNVISRGA
GYMQTVFYRFIQTGRNQFNAAFCVGTNVIFRREAVTEIGGMYTGSKSEDVWTSILLHERG
WRSIYIARTVAVGDTPDTIESYLKQQTRWATGGFELLFTHFPWSPRRRLTVDQRIQYGVT
STFYFTGIMPLVLLVVPPMQIFLDLAPIAASTSVTTWVIFYLGFYGTQVLVAFFSMGSFR
WEVLLLSIVTFPAYVKALWSALTVRDQAWQATGSRRRATSPFAHILPQIITAAFLLLTSL
VGAWKLSHTTDGALALVWNGVNTLIFLGFLFQASVEARRMRRARREAATARR

Enzyme Prediction     

No EC number prediction in MGYG000001480_00594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	178	338	4.7e-29	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.46e-94	175	397	2	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	7.59e-49	107	504	6	388	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11498	bcsA	9.97e-44	164	449	258	533	cellulose synthase catalytic subunit; Provisional
cd06435	CESA_NdvC_like	1.81e-37	183	400	7	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06423	CESA_like	3.09e-34	178	349	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARU50927.1	1.53e-235	74	585	46	557
QJW35673.1	1.59e-233	74	581	46	553
ANC32419.1	3.43e-232	47	578	17	549
QKS18108.1	6.65e-227	77	588	1	513
AOX65892.1	1.17e-226	70	581	60	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.71e-37	74	451	26	432	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.26e-37	74	451	38	444	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.27e-37	74	451	39	445	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.90e-35	164	437	271	544	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	3.44e-35	158	437	151	430	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8X5L7	6.50e-35	164	437	271	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	1.56e-34	164	437	271	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q93IN2	1.56e-34	164	585	255	700	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P58932	2.60e-34	164	428	135	415	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
77	99
106	128
415	437
457	479
483	502
522	544
554	576