CAZyme Information: MGYG000001480_02625

Basic Information

• Species: Pauljensenia polynesiensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia polynesiensis
• CAZyme ID: MGYG000001480_02625
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		89210.78	7.6467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001480	2878449	Isolate	not provided	not provided

• Gene Location: Start: 4688; End: 7084 Strand: -

Full Sequence      

MTHETRDADADTPSRRHQVGAERSTEPLPVLHSRPSAFRLVLGRLAIVVTVLSWAMYVIT
TVLRRVIENELTTLGTVIETVVYLGIVTLLSFSALMYLVSRQGAHIRFRSHQRVPRAQVD
RHFSVPDPRHGITVLIPSYVEETHVVVKTIWSAALQEFPDLQVVLLIDDPPNPGDPERLR
DLETTRRLGETVMSALAAPSSRLTRARDTAGVRLRGVAEVSGAELSRLASEYRWAAHWLE
QMAEDWEVVDHTDQFFVHQVLGDLARDLRTTVTALEGASREHGSLPLARVLQLYDRLAWT
FTASVRTFERKQYASLSHEANKAMNLNAYISLMGHSWKRVETQRGVILREVYEGEYADLE
VPDSEYLLTLDADSMLLREYCLRLVYLLECPENERVAVAQTPYCSYRGAPTRMERIAAAT
TDIQHILHQGLTYYDATFWVGANAVIRKRALDDIAQVSTEGARTVTTYIQDRTVIEDTES
SVDLGLHRWHLVNYPERLSYSATPPDFGSLVVQRRRWANGGLLILPKFIQQMRERRNTSN
AVHLTQAALRINYMASIAWASIGLVFLLAFPFDSRLLSPWVIAAAAPYFLCMAQDLRDSR
YKRTDVFRIYGFNLILLAVNVAGTLKSVQQGLTNEKIPFARTPKVSNRTAAPWPYVLAPL
AIIGLSCVIFVLDWHARNWGNAAFAGFNAVMCTWALVSYIGVRNCLEDLFFGILGWFFVP
VEQPRQDGAPRGHSRGTDWRALLYYGELAQPRGGGAAPVDRASAGTWSPPGHGARPDTDR
SAGGTHPGAVSSGGVDAA

Enzyme Prediction     

No EC number prediction in MGYG000001480_02625.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	367	585	6.9e-27	0.9543147208121827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13632	Glyco_trans_2_3	5.61e-28	366	590	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd06421	CESA_CelA_like	3.28e-20	359	525	80	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.77e-13	363	590	137	354	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	8.03e-10	362	527	83	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
PRK14583	hmsR	2.20e-08	364	567	156	345	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTL81505.1	8.34e-314	9	747	7	740
AZN75405.1	2.38e-313	9	747	7	740
AIZ15243.1	6.54e-313	9	747	6	739
BAR04360.1	6.78e-313	9	747	7	740
AGH41936.1	2.95e-312	10	747	8	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.14e-08	357	525	220	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.19e-08	357	525	232	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.19e-08	357	525	233	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19449	5.08e-06	364	700	229	560	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999965	0.000030	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
40	62
77	99
549	571
576	593
606	625
650	672
679	701