CAZyme Information: MGYG000001481_01130

Basic Information

• Species: Neobacillus sp000821085
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus sp000821085
• CAZyme ID: MGYG000001481_01130
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000001481_1|CGC8	73559.49	4.8278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001481	4702581	Isolate	not provided	not provided

• Gene Location: Start: 1077341; End: 1079299 Strand: +

Full Sequence      

MTKLKKVVSILLAALVVLNISTLGALSDKASAEGTTPEKFVITFDPANGEEMKQLQLGVG
EPLREKRVPFEKIEKEGYDFLGWFYGPNNKYEMIFPYKPNEDMTLTAKWGKHTPASPVQK
EGYRLIFDEEFNNPNGKLDSKLWVDKYLSSWTKTPEYAKPIYDIKNGAMQLQVQEDTPGW
APEYDGETRVSGFTTGNRNGLHNWNGNNVVRNPVQTELTHINQYGYYEIRAKGQAGSSRH
SAWWLLGFEDQVDHSAEIDIFEILGNQKTAVPRAFHNWNDKDAFPVRDAGETFINPNANF
HDEWHTFGLDWQEGTGSGAFPDKLVFYVDGKVVGSKNLNIDYPMIQLFSQYEKRAGGWTG
PWEWMPYPNTFDIDYVRVYKKLPEGQKELSKKELKVVNVEDSEVTVLEGQAALKQYTSAV
AGHEGEIYTEPNLPNTKSYVNVTWNDGVVTQEFVKWDPITQEDLDKINSGEAITKSGILP
NLTGVEGVTNPTLQIVVTTPPPPPPYTSENLGVENSQSQLEKLFDGNLLSNSGEFRFASN
QLPTDKEVNIQYDFHKDITLNSISFSTNYGKDQGIRKFKLAAWDSEAKSWIPAEKEYTIP
WTTAGNTENGETLKVDVEPMKTSKVKIIITDVGLTWGNKIAMREIAFGYVTK

Enzyme Prediction     

No EC number prediction in MGYG000001481_01130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	129	379	8.5e-74	0.991701244813278

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	4.58e-32	129	379	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	7.87e-20	223	379	78	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	6.69e-17	130	380	28	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	1.02e-08	223	377	32	168	Glycosyl hydrolases family 16.
COG2273	BglS	1.84e-06	224	379	118	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ40812.1	0.0	1	647	1	647
AIF44579.1	0.0	4	647	1	641
AWS25493.1	3.39e-100	116	468	251	576
ASY50995.1	3.39e-100	116	468	251	576
QUT50278.1	7.02e-83	114	482	29	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UPS_A	1.12e-39	103	388	10	285	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]
6T2N_AAA	3.53e-07	214	387	135	310	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
1DYP_A	2.56e-06	224	382	97	271	1,3-Alpha-1,4-Beta-D-Galactose-4-Sulfate-3,6-Anhydro-D-Galactose 4 Galactohydrolase [Pseudoalteromonas carrageenovora]
5OCQ_A	2.81e-06	224	388	99	279	Crystalstructure of the complex of the kappa-carrageenase from Pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan [Pseudoalteromonas carrageenovora],5OCQ_B Crystal structure of the complex of the kappa-carrageenase from Pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan [Pseudoalteromonas carrageenovora]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000427	0.997993	0.000971	0.000224	0.000196	0.000165

TMHMM  Annotations     

start	end
7	26