CAZyme Information: MGYG000001481_01858

Basic Information

• Species: Neobacillus sp000821085
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus sp000821085
• CAZyme ID: MGYG000001481_01858
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		30768.38	9.5614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001481	4702581	Isolate	not provided	not provided

• Gene Location: Start: 1870397; End: 1871203 Strand: +

Full Sequence      

MAKNISEFIAIMTAQFPVKRLAIFLAATVLLLPNQANAQQKIPILVYHSIAEFTGSGQKE
LYVTPENFKKQMEYLKEHGFTLMTFEQWDQVNHVKKPIFITVDDGYKDHLNILETFQTLK
DPAFRPAATLFIISDFIGNRNRLSKADLQMLAGTGMFSIQSHTATHPDLTKTTDYKKELE
ESKLKIEQITKRPVIALSYPYGNTNNKVITETRKYYKFGLTTTPGPFVKSNFPEELYTLP
RTYVKYSDTLADFANIVNGLDRKEHRDR

Enzyme Prediction     

No EC number prediction in MGYG000001481_01858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	94	210	7.9e-19	0.8307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	4.41e-36	97	244	1	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	4.03e-25	65	248	1	206	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10967	CE4_GLA_like_6s	7.50e-22	100	255	5	153	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	2.22e-18	95	215	6	119	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10970	CE4_DAC_u1_6s	4.19e-18	98	244	3	145	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADG83187.1	2.83e-27	39	259	36	269
QZY32711.1	9.63e-25	41	260	64	278
VEH39919.1	1.33e-23	39	266	34	278
ADN13976.1	1.67e-23	41	255	934	1159
AVQ31343.1	3.70e-23	39	266	103	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V33_A	4.91e-75	28	257	130	359	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
4HD5_A	9.81e-75	39	257	141	359	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
6GO1_A	1.92e-67	31	257	89	317	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKP8	1.08e-09	34	264	48	289	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
Q6TYB1	1.08e-09	34	264	48	289	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
Q6GDD6	1.43e-06	53	214	66	243	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002624	0.995719	0.000993	0.000233	0.000205	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001481_01858.