CAZyme Information: MGYG000001481_01896

Basic Information

• Species: Neobacillus sp000821085
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus sp000821085
• CAZyme ID: MGYG000001481_01896
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001481_1|CGC12	39324.87	9.9975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001481	4702581	Isolate	not provided	not provided

• Gene Location: Start: 1902160; End: 1903224 Strand: +

Full Sequence      

MATNRIVFTGGGSAGHVTPNLAIIAELDKKKWEIHYIGSEKGIEKELIAKIGIPYHGISS
GKLRRYIDFENVKDIFRVMKGCYDAWKVLKKLKPRLVFSKGGFVSVPVVIAANLLKIPVF
IHESDLTPGLANKIAQRFATKIFTSFEETVNYFPGKKAVAIGSPIRIEILNGSGVQGRKL
LNFNEKKPILTIMGGSLGARKINEAVRGNLPWLTDRFQVVHLCGKGQMDTNLSGLPGYRQ
FEYVHEELPDLLAATDLVITRGGSNSIFEFLALGIPMLIIPLTLQQSRGDQILNAKTFHK
NGFSLTLEEEGLNSESFKKAVDELQLKSQEIKMNMKKVNKQNAIDVLLGEIENY

Enzyme Prediction     

No EC number prediction in MGYG000001481_01896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	341	1.5e-37	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	1.17e-149	5	351	3	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.42e-138	5	352	3	352	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	6.75e-119	5	348	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	8.31e-108	5	354	2	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	9.28e-95	4	347	1	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ08635.1	3.47e-175	1	354	1	354
QQX25793.1	1.15e-173	1	354	1	354
AIM17034.1	3.18e-173	1	354	1	353
QNG61620.1	2.57e-169	6	351	4	348
QKE72585.1	9.48e-168	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	1.50e-34	5	313	8	311	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.10e-32	5	282	4	280	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.08e-31	5	296	11	305	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q812T8	9.78e-142	5	351	3	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG2 PE=3 SV=1
Q730T5	3.22e-140	5	351	3	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG2 PE=3 SV=1
Q5WAE4	1.61e-138	5	352	3	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Alkalihalobacillus clausii (strain KSM-K16) OX=66692 GN=murG PE=3 SV=1
Q6HDR3	1.23e-137	5	351	3	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=murG2 PE=3 SV=1
Q81JE6	1.74e-137	5	351	3	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus anthracis OX=1392 GN=murG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001481_01896.