CAZyme Information: MGYG000001481_02071

Basic Information

• Species: Neobacillus sp000821085
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus sp000821085
• CAZyme ID: MGYG000001481_02071
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		21258.51	10.99

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001481	4702581	Isolate	not provided	not provided

• Gene Location: Start: 2065780; End: 2066379 Strand: +

Full Sequence      

MNRFIKLVIAAGLIFSMSAFTMAGTTEAATTHKVKSGETYYKIAIQHGVPVKTLMSANNA
KSPALNAGRNLTIPNSTVTAAEKDLMARLVRAEAVGEPYAGKVAVATVILNRVASKDFPN
SVKGVVNQVSNGHYAFTPVQNGQINKPADAASKRAVNEALAFKGQGKGSLFFYNPKTAVS
KWIFSRQTTVTIGNHRFAK

Enzyme Prediction     

No EC number prediction in MGYG000001481_02071.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02869	spore_SleB	2.56e-41	84	199	89	200	spore cortex-lytic enzyme. Members of this protein family are the spore cortex-lytic enzyme SleB from Bacillus subtilis and other Gram-positive, endospore-forming bacterial species. This protein is stored in an inactive form in the spore and activated during germination. [Cellular processes, Sporulation and germination]
pfam07486	Hydrolase_2	9.75e-40	96	198	1	101	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
COG3773	CwlJ	6.53e-38	60	199	98	242	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
pfam01476	LysM	3.12e-12	32	74	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.87e-10	30	73	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ43879.1	4.01e-105	1	199	4	203
QIZ10310.1	4.22e-101	1	199	1	197
AZU63736.1	3.83e-100	1	199	1	200
ALC92782.1	1.07e-93	17	199	1	183
AGK55415.1	1.01e-83	1	199	1	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	8.75e-24	68	199	2	128	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	3.29e-22	63	199	93	222	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31685	6.19e-31	77	198	90	207	Uncharacterized protein YkvT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvT PE=2 SV=1
P0A3V0	6.55e-23	24	199	89	259	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	6.55e-23	24	199	89	259	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
Q9KCE0	3.88e-21	85	197	220	328	Spore cortex-lytic enzyme OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=sleB PE=3 SV=1
P50739	1.42e-18	85	199	195	305	Spore cortex-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999166	0.000168	0.000163	0.000145	0.000130

TMHMM  Annotations     

start	end
7	29