CAZyme Information: MGYG000001482_01789

Basic Information

• Species: Planococcus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Planococcus; Planococcus massiliensis
• CAZyme ID: MGYG000001482_01789
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000001482_1|CGC12	24317.72	4.8328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001482	3357017	Isolate	not provided	not provided

• Gene Location: Start: 1797130; End: 1797777 Strand: -

Full Sequence      

MKKKKKKSLAARIRIWFLIFLVPVLLVMTTLAIVVFYVFNPEDIVHTIKETPQQLFELEV
PKENIPLYKEAAETYGIPWTLLAAHHRIETKFSTMDPMLSPVGAEGHLQFMPCTFVGWQH
PTCSGKGEGEISEEEKTDPAVIKEYGGYGVDGNGDGVADPYDLTDALYSAANFLSKYGAA
DGDLETAIFQYNHSETYVNDILHYYHLYEEQFKTP

Enzyme Prediction     

No EC number prediction in MGYG000001482_01789.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	2.68e-29	75	203	1	104	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	3.17e-10	58	178	106	240	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	5.83e-08	100	178	151	200	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
pfam01464	SLT	2.98e-05	69	192	2	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.40e-04	69	114	2	45	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX51907.1	2.75e-119	1	212	1	212
QHJ71408.1	1.03e-107	2	212	3	213
ANU11107.1	1.26e-105	3	212	2	211
ANU28472.1	5.65e-102	4	211	3	210
ANU12992.1	1.14e-101	3	212	2	211

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985033	0.000965	0.000088	0.000009	0.000005	0.013919

TMHMM  Annotations     

start	end
13	35