CAZyme Information: MGYG000001483_00471

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_00471
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		35200.05	7.8997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 91895; End: 92875 Strand: -

Full Sequence      

MGIPADEAARSVLAVFGRRLLAGRLGEIARPGRDRSEWHYWWQAHLVDCLIDAELRGSAA
VRRGSARAVIRGIWLRNRLRFRNLYFDDMAWLALAALRAGRPARGLDVALGSAVTPDGGV
WWNTTRDFRNTAATGPVALYLARTGRRTEAGLLLDWLGAHLADPDTGLFRDGLRMEGGTE
VLVPHVFTYNQGPALGAMLELGRLHDAAALVHAVGEHLTHPGTAVLRTHGSGDGGLFTGI
LCRYLALAAGDDRLPVETREPAAGLVRATAGNLWANREERGWRGRGVVVFPQDTAPEGAG
VGERVELSTQLQAWMALEAELACSAG

Enzyme Prediction     

No EC number prediction in MGYG000001483_00471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	282	2.1e-50	0.770949720670391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	2.68e-43	30	319	35	366	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	6.97e-11	117	270	134	310	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEP41093.1	6.40e-142	5	319	6	326
AQX16445.1	6.40e-142	5	319	6	326
AQP43740.1	3.25e-128	5	319	13	335
QXT62305.1	3.12e-124	2	324	3	335
AQP46300.1	1.77e-114	5	319	6	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.13e-28	26	320	74	386	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.88e-27	26	320	75	387	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.97e-26	26	320	75	387	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	1.31e-12	31	244	36	274	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999999	0.000039	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001483_00471.