CAZyme Information: MGYG000001483_00824

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_00824
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		25584.11	6.2532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 255969; End: 256673 Strand: +

Full Sequence      

MSLTGTAGTAPSRAMGQCMEYCAWLLQHPGATPTLMLRDLQVADATRRSNMSRLRTWLGA
DEESLPYLPDAYTGRIMLDDRVTSDWEQFTALLSGGVNMAGTAALRDALELVRGEPLGTF
AFQWHWAQQLRADMVAMIVDAACVLADRSLSQGDLDTALWAIAQGRLGAPLDDALAVREV
EALAQAGRRADAEHAVVRLNRSLRADGRDLEPALAIRIQDALRRSTRPGARRSR

Enzyme Prediction     

No EC number prediction in MGYG000001483_00824.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart01043	BTAD	5.63e-06	85	214	2	137	Bacterial transcriptional activator domain. Found in the DNRI/REDD/AFSR family of regulators. This region of AFSR along with the C terminal region is capable of independently directing actinorhodin production. This family contains TPR repeats.
COG4948	RspA	0.008	124	231	63	190	L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily [Cell wall/membrane/envelope biogenesis, General function prediction only].
pfam03704	BTAD	0.008	90	217	14	139	Bacterial transcriptional activator domain. Found in the DNRI/REDD/AFSR family of regulators. This region of AFSR, along with the C terminal region, is capable of independently directing actinorhodin production. This family contains TPR repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO37425.1	2.79e-120	1	227	665	891
AQP50973.1	2.29e-97	1	226	671	896
AQP45822.1	4.14e-94	1	223	664	885
VEP40458.1	8.80e-91	1	222	652	873
AQX15971.1	8.80e-91	1	222	652	873

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001483_00824.